6O3V


Conserved Protein Domain Family
Rotavirus_VP3

?
pfam06929: Rotavirus_VP3 
Rotavirus VP3 protein
This family consists of several Rotavirus specific VP3 proteins. VP3 is known to be a viral guanylyltransferase and is thought to posses methyltransferase activity and therefore VP3 is a predicted multifunctional capping enzyme.
Statistics
?
PSSM-Id: 399720
Aligned: 3 rows
Threshold Bit Score: 947.462
Threshold Setting Gi: 75567292
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6O3V_A   1 MKVLALRHSVAQV-YADTQIYTHDDTKDSYENAFLISN-LTTHNILYF-----NYSARTLEILNKSGIAAIEIQSlEELF 73 
A2T3S5   1 MKVLALRHSVAQV-YADTQVYVHDDTKDSYENAFLISN-LTTHNILYL-----NYSIKTLEILNKSGIAAIALQSlEELF 73  Simian rotavirus A/SA...
Q82041   1 MRVLGLFERGNNLnFADTYVYTWNQQYSYHENAFLISNqVATTIILYLdginiNEVNKAFELLNSNGIPALIIKP-DHIG 79  Human rotavirus C/Bri...
6O3V_A  74 TLIRCNFTYDYENNVVYLHDYSYYTNNE-IRTDQHWITkTNIEEyLLPgWKLTYVG------YNGNDtrghynfsFTCQN 146
A2T3S5  74 TLIRCNFTYDYELDIIYLHDYSYYTNNE-IRTDQHWITkTNIEEyLLPgWKLTYVG------YNGSEtrghynfsFKCQN 146 Simian rotavirus A/SA...
Q82041  80 IFTSSNFTYDWQYKIVYFHEYTYYKNNEfIVSDEFWLY-TNINE-LLP-YKILYYErgmrelYAGRE--------YTLYN 148 Human rotavirus C/Bri...
6O3V_A 147 AATDDDIIIEYIYSE-----ALDF---------QNFMLRKIKERMTTSLPIARLSNRVFRDKLFpllvkkHKRVVNVGPR 212
A2T3S5 147 AATDDDLIIEYIYSE-----ALDF---------QNFMLKKIKERMTTSLPIARLSNRVFRDKLFpsllkeHKNVVNVGPR 212 Simian rotavirus A/SA...
Q82041 149 TATDDDILYKYIYEKdsimnGTDYkklydtnsvKNFVHFMRLLRMRFAVPFDQLSNRITRSRVF------SKSRIHIGLR 222 Human rotavirus C/Bri...
6O3V_A 213 NESM--------FTFLNFPsirqfSNGpylvkntIKLKQERWLG----KRVSQFDIGQYKNMLNVITTIYHYYNLyQEKP 280
A2T3S5 213 NESM--------FTFLNYPtikqfSNGaylvkdtIKLKQERWLG----KRISQFDIGQYKNMLNVLTAIYYYYNLyKSKP 280 Simian rotavirus A/SA...
Q82041 223 NESIpqaldnihSQWINYS-----ANG-------IVISELKGLGsyseKKISEFGIGQFKNYMNFLTLMFYIKNM-KKKP 289 Human rotavirus C/Bri...
6O3V_A 281 IIYMVGSAPSYWIYDVRQYsdFLFETWDPLDTPySSIHHKELFFAKDIGKLKDNSIlYIDIRTDRGNADWKEWRKVVELQ 360
A2T3S5 281 IIYMIGSAPSYWIYDVRHYsdFFFETWDPLDTPySSIHHKELFFINDVKKLKDNSIlYIDIRTDRGNADWKKWRKTVEEQ 360 Simian rotavirus A/SA...
Q82041 290 SCTIIGAAPGYWISSMKKY--FTIVTYDNKEVD-STEHHNRYFTDDDIVNVKTNGV-YIDVRSEFKTNDWRQRRKLIEEE 365 Human rotavirus C/Bri...
6O3V_A 361 TISNLNLAYQYLATGKSKVCCVKLTAMDLELPvSAKLLHHPTTEIRSEFYLLLDIWDVNNIKRFIPKGALYSFINNVITD 440
A2T3S5 361 TINNLDIAYEYLRTGKAKVCCVKMTAMDLELPiSAKLLHHPTTEIRSEFYLLLDTWDLTNIRRFIPKGVLYSFINNIITE 440 Simian rotavirus A/SA...
Q82041 366 TIKWLEISYKLLENKRVEAILLKMTAMDGEIP-DGYCVHSPTTYRKSEYYLLIDKHIIKRQKIKVTKSLMYNAINTIYSD 444 Human rotavirus C/Bri...
6O3V_A 441 NVFIQSPFKIRTSVSDyIVALYALSNDFNNREDIINLINNQKQSLITVRINNTFKDEPKVGFKSIYDWTFLPTDFETT-N 519
A2T3S5 441 NVFIQQPFKVKVLNDSyIVALYALSNDFNNRSEVIKLINNQKQSLITVRINNTFKDEPKVGFKNIYDWTFLPTDFDTK-E 519 Simian rotavirus A/SA...
Q82041 445 NVFISGKYSLRGKTEG-VLALYCLSNTINQKEKVIQYANSFSGTCMTVRLNNTYEVDKIIDFKTNSDHTFLPSDFTCSlN 523 Human rotavirus C/Bri...
6O3V_A 520 AIVTSYDGCLGIFGLSISLASKPTGNNHLFILNGTDKYYKLDQFANHTGISRRSHQVRFSESATSYSGYIFRDLSNSNFN 599
A2T3S5 520 AIITSYDGCLGLFGLSISLASKPTGNNHLFILSGTDKYYKLDQFANHTSISRRSHQIRFSESATSYSGYIFRDLSNNNFN 599 Simian rotavirus A/SA...
Q82041 524 TILTSYRGYAGIFGYAITKDLKSNGNNHIYIIPNARDENNFDTFGSHLGLSRYSHSKRFSESATTMSGYIFRDMVSGKEN 603 Human rotavirus C/Bri...
6O3V_A 600 LIGTNVENSVSGHVYNALIYYRYNYSFDLKRWIYLHSVEKANIEGGKYYEHAPIELIYACKSAKEFASLQDDLTVLRYAN 679
A2T3S5 600 LIGTNIENSVSGHVYNALIYYRYNYSFDLKRWIYLHSIDKVDIEGGKYYELAPIELIYACRSAKEFATLQDDLTVLRYSN 679 Simian rotavirus A/SA...
Q82041 604 MQDTDKDNYASGHVFNAIAHYRFDYTYDIVGWLRLHKTGQFKVKSDIYKEHTDSEIRNAIESAYVYYLLDGDKVGEKYSK 683 Human rotavirus C/Bri...
6O3V_A 680 E-IENYINK 687
A2T3S5 680 E-IENYINT 687 Simian rotavirus A/SA11-H96
Q82041 684 KmMEIWEVQ 692 Human rotavirus C/Bristol
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap