Conserved Protein Domain Family
DUF1281

?
pfam06924: DUF1281 
Protein of unknown function (DUF1281)
This family consists of several hypothetical enterobacterial proteins of around 170 residues in length. Members of this family are found in Escherichia coli, Salmonella typhimurium and Shigella species. The function of this family is unknown.
Statistics
?
PSSM-Id: 399719
View PSSM: pfam06924
Aligned: 6 rows
Threshold Bit Score: 285.493
Threshold Setting Gi: 490366062
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_004245726  32 IPAWQTAIAQSLHLLLAGCAGILKPVRPLSFPPLPELTSYgaTGPVSPGNTAFTHWVDLLMTAPDLTPSCCQQIHQWYQm 111 Enterobacterales
CBJ80690      30 VPRYRQAVLQSLRLFLAGCAGILKPTKPQTYTPYPALVRG--TAVPTAQHLAFEQWLLLLQNNVPLNNDNIKRIDNLYR- 106 Xenorhabdus bov...
CAX53365      30 VPLYRHAVMRSIKLFLAGCGGLLRPVKTESFTPFPGLMQSg-TGLGTPANMAFDQWLGLLRRDVPLDGEHLRTIERIYH- 107 Erwinia billing...
ACR67606      30 TPRYRHAILQSIQLFLAGCAGILKPVRTVSYIPFQGLVRHg-IGQSTAANLAFEQWLELLQKDVALDTETIRRIDRLYH- 107 Edwardsiella ic...
Q7N7T0        30 IPYYGQAIHQSIKLFVAGCAGLLQPTETIDYPLYPALVAGg-VGEMSPENWAFEQWLALLKENVALDEVTSQQIDRLYQ- 107 Photorhabdus la...
KJG19234      30 EITYQRAVIASQKLFLAGIGGILKPTETMVYLPYPALVQG--IGSPTPENQAFTRWLQLLSDNVELMQERAEEILSLFE- 106 Photobacterium ...
WP_004245726 112 wlSEGGAYHSWDSLTATQKARLSPLLSGSSFDWLNRFTGEDESRVATAWEDIQYLRSTgeAIPM-----DMRTLLPTSLA 186 Enterobacterales
CBJ80690     107 --QSGLSLMQWDKVPEAARDIIARLLTRQYIDWFGMVGWSDTPDIGACWDKLNVYPQA--AQPC-----DMLMMMSTNLA 177 Xenorhabdus bov...
CAX53365     108 --QSGIDAIRWESIPEVSRRHIARLIEERYADWFGVATLSREIVPGQCWERLSHLPER--AQPC-----DMLQIIPSRLA 178 Erwinia billing...
ACR67606     108 --QSGLGALKWENIPLASRDIMATLMKRQYADWFGLAGMNDEPDAAACWERLREYPER--SQPC-----DMLMVIPTRLA 178 Edwardsiella ic...
Q7N7T0       108 --QSGLAERKWETLLPTAQKTIMALFNQKSCDWFGLVDWNGERDTEMLWSHLDDRLTE--TVPC-----DLFLLIPTRLA 178 Photorhabdus la...
KJG19234     107 --QSNIKNVVWGSIPKKKRMAMKVVFEQKRYDWSGFFT---RVSLDYFWTQCDVLA----KMPCynvdfNMALIIPPLLA 177 Photobacterium ...
WP_004245726 187 AELHGfNGCLWKTPEviwrqarwqafapgnSTYHLYQCRYGVKWP 231 Enterobacterales
CBJ80690     178 TEING-NSGLLKGIP---------------TTAQFYEEQYGLEWP 206 Xenorhabdus bovienii SS-2004
CAX53365     179 AELNG-TGGLLAGMS---------------TASSLYCRQYGMEWP 207 Erwinia billingiae Eb661
ACR67606     179 TELNG-SGGLLAGIS---------------TTVSFYSHIYGMEWP 207 Edwardsiella ictaluri 93-146
Q7N7T0       179 SEINGfYGGLLKDHE---------------TTHELYFRLYGMTRP 208 Photorhabdus laumondii subsp. laumondii
KJG19234     178 VEINGfNGGFLQHVA---------------RGYDDALCRYGTKWT 207 Photobacterium iliopiscarium
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap