Conserved Protein Domain Family
CTV_P13

?
pfam06922: CTV_P13 
Citrus tristeza virus P13 protein
This family consists of several Citrus tristeza virus (CTV) P13 13-kDa proteins. Citrus tristeza virus (CTV), a member of the closterovirus group, is one of the more complex single-stranded RNA viruses. The function of this family is unknown.
Statistics
?
PSSM-Id: 115570
View PSSM: pfam06922
Aligned: 3 rows
Threshold Bit Score: 225.654
Threshold Setting Gi: 81981715
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9YN81   1 MSIRRVWLKVIAVITVLWYCKEPSISEGYNALMNDDFKFIDTHFSNVSYAKKCYDLANFDLDFLRIVIIPLSGGTANESR 80  Citrus tristeza virus
Q66243   1 MSIRRSWLKVMAVVTVLWYGKEPSISEGYNALMNDDFKFIDTHFTNVSYAKKCYDLANFDLDFLRIVIIPLSGGTVNESR 80  Citrus tristeza virus
Q9DTF6   1 MGIRRVWLKIMAVITVLWYGKEPSISEGYNALMNDDFKFIDTHFSNVSYAKKCYELANFDLDFLRIVIIPLSGGAVNESR 80  Citrus tristeza virus
Q9YN81  81 SDRTNVSEIVESHVSDRDRMHILLRNKRIQIPSLLPCDN 119 Citrus tristeza virus
Q66243  81 ADRTNVSEIVESHVSDRDRMSILLRNKRIQIPSLLPCDN 119 Citrus tristeza virus
Q9DTF6  81 ADRANVSEIVESHVSDRDRMKILLRNKRIQIPSLLPCDN 119 Citrus tristeza virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap