Conserved Protein Domain Family
Pectate_lyase_2

?
pfam06917: Pectate_lyase_2 
Periplasmic pectate lyase
This family consists of several Enterobacterial periplasmic pectate lyase proteins (EC:4.2.2.2). A major virulence determinant of the plant-pathogenic enterobacterium Erwinia chrysanthemi is the production of pectate lyase enzymes that degrade plant cell walls.
Statistics
?
PSSM-Id: 369135
View PSSM: pfam06917
Aligned: 2 rows
Threshold Bit Score: 1201.09
Threshold Setting Gi: 81645142
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6D5A5  13 VALQASATTPDRLTIVNQYVDNVLAKAGDHYHGQSPTPLLADGVDPRTGKQMEWIFPDGRQAVLSNFSAQQNLMRVLVGL 92  Pectobacterium atrose...
Q6D5A5  13 VALQASATTPDRLTIVNQYVDNVLAKAGDHYHGQSPTPLLADGVDPRTGKQMEWIFPDGRQAVLSNFSAQQNLMRVLVGL 92  Pectobacterium atrose...
Q6D5A5  93 SNLSGNASYKQRAEAIVKYHFQHYQDESGLLIWGGHRFVDLKTLQPEGPSEKEMVHELKNAYPYYDLMFSVDKDATARFI 172 Pectobacterium atrose...
Q6D5A5  93 SNLSGNASYKQRAEAIVKYHFQHYQDESGLLIWGGHRFVDLKTLQPEGPSEKEMVHELKNAYPYYDLMFSVDKDATARFI 172 Pectobacterium atrose...
Q6D5A5 173 RGFWNAHVYDWKIMETSRHGKYGQKMGALWQSPFEQQPPFFATKGLSFLNAGNDLIYSASLLYKYNKEDGALVWAKRLAQ 252 Pectobacterium atrose...
Q6D5A5 173 RGFWNAHVYDWKIMETSRHGKYGQKMGALWQSPFEQQPPFFATKGLSFLNAGNDLIYSASLLYKYNKEDGALVWAKRLAQ 252 Pectobacterium atrose...
Q6D5A5 253 QYVLPRDKATGLGVYQFTQALKRDETTDDADTHSKYGDRAQRQFGPEFGPTALEGNMMLKGRTSTIYSENALMQIQLGKD 332 Pectobacterium atrose...
Q6D5A5 253 QYVLPRDKATGLGVYQFTQALKRDETTDDADTHSKYGDRAQRQFGPEFGPTALEGNMMLKGRTSTIYSENALMQIQLGKD 332 Pectobacterium atrose...
Q6D5A5 333 LGAEGKELLTWTTDGLKAFAKYAYNAPDNTFRPMLANGKDLSNYVLPRDGYYGKKGTVLKPYAADNSFLLSYARAYTVSP 412 Pectobacterium atrose...
Q6D5A5 333 LGAEGKELLTWTTDGLKAFAKYAYNAPDNTFRPMLANGKDLSNYVLPRDGYYGKKGTVLKPYAADNSFLLSYARAYTVSP 412 Pectobacterium atrose...
Q6D5A5 413 DAELWRVARGIAGAQGLGELGSAPGKDVKVDLATKNNDPYALFALLDLYQASKVKDYLSLAEKVGDNMISTRYKNGFFMA 492 Pectobacterium atrose...
Q6D5A5 413 DAELWRVARGIAGAQGLGELGSAPGKDVKVDLATKNNDPYALFALLDLYQASKVKDYLSLAEKVGDNMISTRYKNGFFMA 492 Pectobacterium atrose...
Q6D5A5 493 ETNRQYADVDTIEPYALLALEAAVRNQPQSVAPFLNGAGFTEGGYRLEDGSTRVSTRDNELFLLNVGETLKPNNKK 568 Pectobacterium atrosepticum
Q6D5A5 493 ETNRQYADVDTIEPYALLALEAAVRNQPQSVAPFLNGAGFTEGGYRLEDGSTRVSTRDNELFLLNVGETLKPNNKK 568 Pectobacterium atrosepticum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap