Conserved Protein Domain Family

pfam06910: MEA1 
Male enhanced antigen 1 (MEA1)
This family consists of several mammalian male enhanced antigen 1 (MEA1) proteins. The Mea-1 gene is found to be localized in primary and secondary spermatocytes and spermatids, but the protein products are detected only in spermatids. Intensive transcription of Mea-1 gene and specific localization of the gene product suggest that Mea-1 may play a important role in the late stage of spermatogenesis.
PSSM-Id: 399714
Aligned: 26 rows
Threshold Bit Score: 95.2766
Threshold Setting Gi: 321456709
Created: 21-May-2020
Updated: 7-Aug-2020
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
KDR09328                     65 VHSGYQLLAQGPNDLnnteneddsvsadilpgssvADVivadpVDSEDAGASHVVLDqcnLENDRraevkELWSG--SSN 142 ...
ETN58453                     45 GYAGYQPLSVDERNPstlrvipmdd-yeaqsdeseTGN----------------AVAdtdTTNHIeflnlDVWNAp-RPD 106 ...
KFB39777                     44 AYEGYQPLNVDELNQpnrrlspmeddmesgmdvdsNDP----------------AESdprSTVNTellnvDVWNAp-RPN 106 ...
WGS:AAAB:ENSANGP00000030856  51 GYAGYQPLNMDELNHpnrrpslmedeaesgvgegeTVG------------------LdvaNSINAdflnvDVWNAp-RPN 111 ...
VDO09384                     61 ENGSTIPLDDTGVDEalmrvlnsdgthfgsfpvseEPK-----------------------DEPDesspaLLWNEprKDA 117 ...
ERL91740                     42 PWGGYMPLAQNPADSealfrssndsdedegideeqPPA------------------AeqgIKDSSsvqveEVWSQp-APK 102 ...
XP_001602458                 36 GPAGYMPLSQIPAEGepledenddddedfewthapTEP------------QQSLPESnepGEPSVdpetlEVWSA--PGN 101 ...
XP_017797647                 37 GMAGYVPLSQIPADSdpmlyededdewisnagepsQAF----------------PTPsldSQQDCmsetiEVWSS--SYN 98  ...
EZA60349                     37 GMAGYVPLSQVSTDAdpildddendewlsgigessQAQ---------------ASSStvdSQQSCssevlEVWSC--SQN 99  ...
XP_001357013                 68 AEAITVPVDDDDD------------------------------IDLTTAAVTHGDPNmppIESADieierQVWNEp-RPQ 116 ...
XP_001357013                117 ELQMELDKTRTEQILKAMSTISLPNITVPDWAKGVPEERWKLELLERINSRQQP 170 Drosophila pseudoobscura p...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap