1WNH


Conserved Protein Domain Family
Latexin

?
pfam06907: Latexin 
Click on image for an interactive view with Cn3D
Latexin
This family consists of several animal specific latexin proteins. Latexin is a carboxypeptidase A inhibitor and is expressed in a cell type-specific manner in both central and peripheral nervous systems in the rat.
Statistics
?
PSSM-Id: 399712
View PSSM: pfam06907
Aligned: 18 rows
Threshold Bit Score: 328.501
Threshold Setting Gi: 542245187
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1WNH_A         9 THYAASRAASVAENCINYQQGTPHKLFLVQTVQQASKEdI-PGRGHKYHLKFSVEEIIQK---QVTVNCTAEVLYPQMGQ 84  house mouse
XP_005325765  61 SWAMLQQAARVALHFFNFHSGSPSELQVLANVQTG-GWqVdPQRGYHINLVFSTESYHLQdgkPRLGKCFARVFFQNQKP 139 thirteen-lined ...
Q90YI1        41 SHREAVWAAWTALHYINSHEASPSRPLALHKVVKAASKmI-PRLGWKYYVHCTTEGYIHG---ENAGSCFATVLYLKKSP 116 chicken
XP_006002224  37 HNRYAWQAAKVAVYYLNYRSGSPNKVFTLDRVRKASLEsI-QNAGHKYYVQFTVGDVSSN---GAIGTCIGKVIFQKQKP 112 coelacanth
XP_006002222  31 SHKSATRAVRAAEHWLTYNYGSPHKAFITEWVKKAAVEdI-PGVGNKYHIQFSVKDAVTE---QNAGSCSAEVLYQTGH- 105 coelacanth
XP_015216458   9 SHYQASRAAKVAEHYLNYHYGSPFRRFIIRQVKRATLEeI-PTGAARYHIEFSLEEMVSN---TTIGNCAAEIVFERTEE 84  spotted gar
XP_002933286   7 SHYPATRAATVAQDYMNYTLGGPYRLFALNTVSQAGRErI-AGVGNKYSLTFSIEDSLND---KHIINCTSEVLYYLSEQ 82  tropical clawed...
NP_001264417   7 THGPASRAAALATAYISHRHGSPGHGWVLRDVRRARREdI-DDIGHKYHLEFVLEDIFEK---DSTVNCTAEVLYHLGNE 82  chicken
XP_008104315  59 GNFPATRAARLLAHYITAQRGSPSRLFQVPTVLQARREhI-PGVGNKYHLKVSLEEALQK---SNAVNCTAEILYHHSDP 134 green anole
KAE8604083    36 SQRAAREAGRVAVQYLNYYSGSPHQLVYLDVVRKATVKsV-PEIGDKFYIEFTTKDYQTN---QEVRVCTASVFFRQRQA 111 tropical clawed...
1WNH_A        85 GSAPEVNFTFEGEIGKNPDEeDNTFYQSLMSLKRPLEAQDIPDNFGNVSPQMKPVQHLAWVACGYVMWQNSTEDTWYKML 164 house mouse
XP_005325765 140 RPAITMTCTGLSEKNRTLQE-DHLLYEQLKQMKDALTVGGIPDDYGYIDPSVRPIWDLAILGSSYVMWERTTQFSYYYPL 218 thirteen-lined ...
Q90YI1       117 -PVVHGKC-VHAQNKKQIQEeDHRFYEYLQHQKKPITANYIPDSNGNIAHDHLQLWGLAIVGSSYIMWKQSTEHTGYLLA 194 chicken
XP_006002224 113 RPATDVKCKFNKDLKRQVLDaDHKLYHKLKKQKKLLAAKNIPDNFGHVDPPMEPIWHMAMIGSSYVMWQKSTENLQYNLM 192 coelacanth
XP_006002222 106 RSAPDVKIEIQGTFGRHTQEeDEEFYLKMKNRQEPLVGQDIPDSFGNVSAEMKPIWTLAIVGSSYIMWQNSTENTLYNMA 185 coelacanth
XP_015216458  85 QKTPQVQCTCDDLLKINTSEaENSFFHQIKKSSALVSGQYIPDSYGFTAPEMTPLWHLGGVAASFVMLKESNESTLYNMA 164 spotted gar
XP_002933286  83 HTAPSVTFTLQGELQGNTMDkDKEFYNKIRSLTQPLMAQDIPDKFGNVPAELEPVWHLALAACGYVKWQNSTENTFYRMA 162 tropical clawed...
NP_001264417  83 KSAPDVQFTIEGELK-NTDEaDNAFYNRIQSLKKELEAENIPDSYGNVSPEMQPIRALAWAASGYVIWQNSTENTKYQLA 161 chicken
XP_008104315 135 HVAAEVHYTVEGELEINTEEaDNKFYNKIKNLSEPLEAQKIPDNYGNMVAEMEPVRHLALVACAYVIWQISTEDTLYNLA 214 green anole
KAE8604083   112 KPAIHVNCSTSGSLMKARED-DYNFYRQMKKQITPISGKDIPDSFGFIDPDMLPVWYLAIMGSSFAIWEKTSEERSYTMA 190 tropical clawed...
1WNH_A       165 KIQTVKQVQRN-DDFIELDYTILLHDIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEG 222 house mouse
XP_005325765 219 QLSRVKQWKTS-DHAIDFDYTVLLHEFPTQEIIPCHIHLIWYPGKPLKVKYRCEEIQTP 276 thirteen-lined ground squirrel
Q90YI1       195 QVSSVKQQIRK-DNAVAFKFIVLLHEIPTQQLNVCHMYLVWTLGHPIRVKYSCAPDNHG 252 chicken
XP_006002224 193 QVKQVKQWKRK-DDLFDFDFKILLHEIPTQEMIPCHMRMVWHPKLSPKVKYHCVhrfpf 250 coelacanth
XP_006002222 186 QVKSVKQVKRNdDDALEFEYTVLLHELISQEIIPWQMKVFWHPKEGIKVEEQAC----- 239 coelacanth
XP_015216458 165 QILSLQQQESE-GESLEFDYEVLLHEFISQEMIQWHMKVNWSPTEGVKVTQSNLQPKHh 222 spotted gar
XP_002933286 163 VIKSVKQQKREeDSALEFHYDMLIHEMVSQGMVPWQIEVLWDPSGGLKVVKQVRLPKQC 221 tropical clawed frog
NP_001264417 162 QIKHVKQVKRT-DEYLEFDYVILLHENVSQEIIPWQMTVLWHPQHGIEVTQNSCQPKHA 219 chicken
XP_008104315 215 QIESVKQVKRK-DDYLEFSFVVLLHDMVSQEIIPWHMQVLWHPQHGVKVTQNSRQPKRA 272 green anole
KAE8604083   191 QIKTVQQLPRK-DDSIAFDYDILLHELPTEEMIFCSLHIVWIPGKPPKVDYECSHNAen 248 tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap