Conserved Protein Domain Family
DUF1272

?
pfam06906: DUF1272 
Protein of unknown function (DUF1272)
This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Statistics
?
PSSM-Id: 399711
Aligned: 39 rows
Threshold Bit Score: 69.1726
Threshold Setting Gi: 315472727
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015159400             1 MLELRPTCEHCNKALPPDSLEARICTYECTFCATCVDSIlgNNICPNCGGGFVSRPIR 58  Chamaesiphon minutus
BAK66939                 1 MLEMRPDCERCGADLPADAGGAFICSFECTFCATCAEEM--DDRCPNCGGDLLDRPTR 56  Sphingobium sp. SYK-6
zhongguo:PM3016_2491     2 GLEMRDRCETCTKALDRTS-TAYICTHECTFCPECTEAV--HHVCPNCGGELVKRP-R 55  Paenibacillus mucilaginosus...
jgi:Bcell_1057           2 ALEMRKFCEACERSISIEA-DAYICTYECTFCEPCTENM--KYICPNCGGELVKRP-K 55  Bacillus cellulosilyticus D...
PRJNA212797:N288_02465   2 GLEMRKECERCSAPLRLDD-TAFICVYECTFCRDCTEEM--ENICPNCGGELVKRPRK 56  Bacillus infantis NRRL B-14911
Q81B25                   2 ALEMKTNCQICDQSLEQDS-EAYICVYECTFCAPCTEER--HNVCPNCGGELVRRPKK 56  Bacillus cereus ATCC 14579
BAJ29020                 2 ALTMRDRCERCETAVLPPDASARICSYECTFCPACSDAM--RHVCPNCGGELLPRPRR 57  Kitasatospora setae KM-6054
WP_013005687             2 ALEMRDRCERCATTVLPADAPARICSYECTFCVPCGEAL--REICPNCGGELVARPRR 57  Streptomyces scabiei
CCA57461                 2 ALEMRERCERCEVAVLVADGPARICSYECSYCVPCADEM--RNVCPNCGGELVPRPRR 57  Streptomyces venezuelae ATC...
Q5YVX3                   1 MLRMKSRCEPCGATLRPDG-EAWICSYECTYCPTCHTGL---DSCPNCAGELVPRPRR 54  Nocardia farcinica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap