5EDJ


Conserved Protein Domain Family
FrpC

?
pfam06901: FrpC 
Click on image for an interactive view with Cn3D
RTX iron-regulated protein FrpC
This family consists of several RTX iron-regulated FrpC proteins which appear to be found exclusively in Neisseria meningitidis. FrpC has been shown to be related to the RTX family of bacterial cytotoxins. FrpC is found in the meningococcal outer membrane. The function of this family is unknown although it is thought to be a virulence factor.
Statistics
?
PSSM-Id: 399706
Aligned: 3 rows
Threshold Bit Score: 441.126
Threshold Setting Gi: 81784485
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5EDJ_A   2 EQTSFNNPEPMTGFEHTVTFDFQGTKMVIPYGYLARYTQDNATKWLSDTPGQDAYSINLIEISVYYKKTDQGWVLEPYNQ 81  Neisseria meningitidi...
Q9K0L0  44 EQTSFNNPEPMTGFEHTVTFDFQGTKMVIPYGYLARYTQDNATKWLSDTPGQDAYSINLIEISVYYKKTDQGWVLEPYNQ 123 Neisseria meningitidi...
Q9JYV7  44 EQTSFNNPEPMTGFEHTVTFDFQGTKMVIPYGYLARYTQDNATKWLSDTPGQDAYSINLIEISVYYKKTDQGWVLEPYNQ 123 Neisseria meningitidi...
5EDJ_A  82 QNKAHFIQFLRDGLDSVDDIVIRKDACSLSTTMGERLLTYGVKKMPSAYPEYEAYEDKRHIPENPYFHEFYYIKKGENPA 161 Neisseria meningitidi...
Q9K0L0 124 QNKAHFIQFLRDGLDSVDDIVIRKDACSLSTTMGERLLTYGVKKMPSAYPEYEAYEDKRHIPENPYFHEFYYIKKGENPA 203 Neisseria meningitidi...
Q9JYV7 124 QNKAHFIQFLRDGLDSVDDIVIRKDACSLSTTMGERLLTYGVKKMPSAYPEYEAYEDKRHIPENPYFHEFYYIKKGENPA 203 Neisseria meningitidi...
5EDJ_A 162 IITHRNNRINQTEEDSYSTSVGSCINGFTVQYYPFIREKQQLTQQELVGYHQQVEQLVQSFVNNSNKK 229 Neisseria meningitidis MC58
Q9K0L0 204 IITHWNNRVNQAEEDNYSTSVGSCINGFTVQYYPFIREKQQLTQQELVGYHQQVEQLVQSFVNNSSKK 271 Neisseria meningitidis serogroup B
Q9JYV7 204 IITHRN--YHRYGENDYSTSVGSCINGFTVRYYPFIREKQQLTQQELVGYHQQVEQLVQSFVNNPSKK 269 Neisseria meningitidis serogroup B
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap