Conserved Protein Domain Family
WzyE

?
pfam06899: WzyE 
WzyE protein, O-antigen assembly polymerase
This family consists of several WzyE proteins which appear to be specific to Enterobacteria. Members of this family are described as putative ECA polymerases this has been found to be incorrect. The function of this family is unknown. The family is a transmembrane family with up to 11 TM regions, and is necessary for the assembly of O-antigen lipopolysaccharide.
Statistics
?
PSSM-Id: 399705
Aligned: 6 rows
Threshold Bit Score: 657.619
Threshold Setting Gi: 503084983
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ACR67360              1 MTLMQFAGLTLVYFFSLLFVAFLTYKEFRRVRFNFNVFFSLLFLLTFYFGFPLTCTLVFRFDVATVPAEEMLYALLSATA 80  Edwardsi...
Q8ZAF1                1 MTLGQFGGLFCIYLIAVIFILTLTYQEFRRVKFNFNVLFSMLYLLTFYFGFPLTCMLVFQFGVAVVPVEYLLYAMLSATA 80  Yersinia...
goetting:EBL_c37910   1 MSLLQFCGLFVVWLCAVLFIGTVTLQAFRQFRFNFHAFFSLLFLLTFYFGFPLTSVLVFRFNVSVVPPEMLLQALLSATG 80  Shimwell...
Q329X2                1 MSLLQFSGLFVVWLLCTLFIATLTWFEFRRVRFNFNVFFSLLFLLTFFFGFPLTSVLVFRFDVGVAPPEILLQALLSAGC 80  Shigella...
WP_013319850          1 MTEWAFFGLWLVWLGGGGVVLWLSGREFRRWRFNFNVLFSLLYLLTFYFGFPLTALLTFRFGVETASPLNLLLALLSATA 80  Dickeya ...
Q2NQC5                1 MTLAQFGGLLVVYILSLTLVAALTYREFRWVRFNFNVFFSLLYLLTFYLGFPFTCLLVFRYGVEVVPVDNLLEALLAATS 80  Sodalis ...
ACR67360             81 FYALYYVTYKTRLRSATS-APGSGs--aWLQLNRVEAQLTWILLALVALVTVTIFFLNNGFLLFKLHSYSQIFSSGVSGV 157 Edwardsi...
Q8ZAF1               81 FYGIYYVTYKTRLRQPRS-QPRTP----IFTMNRVETNLTWVLLALVAVGTVGIFFMQNGFLLFKLDSYSKIFSSDVSGV 155 Yersinia...
goetting:EBL_c37910  81 FYGIYYVAYKTRLRR----APPAPggngLFTMNRVETNLMWGLLMLVALVSVSVFFMHNGFLLFKLQSYSQIFSSEVSGV 156 Shimwell...
Q329X2               81 FYAVYYVTYKTRLRKRVAdVPRRP----LFTMNRVETNLTWMILMGIALVSVGIFFMHNGFLLFRLNSYSQIFSSEVSGV 156 Shigella...
WP_013319850         81 FYVIYYVSYKTRLRSAPPvSRPLP-----LTMTRLEALLTAGLLALVALVTAAVFFANNGLLLFKLSSYSQIFSRDVAGV 155 Dickeya ...
Q2NQC5               81 FYGIYYVSYKTRLFARPR-GPRPP----WFSISRTEIHLLWLLLALIALATVLIFFMQNGFLLFRLRAYSQIFSSDVSGV 155 Sodalis ...
ACR67360            158 ALKRFFYFFIPAMLVVYFLRQTQAAWLFFLVSTVIFGLLTYVIVGGTRANIIIAFALFLFIGIQRGWITLWMLALAGVVG 237 Edwardsi...
Q8ZAF1              156 ALKRFFYFFIPAMLVVYFLKQDRRAWFFFLASTVAFGILTYVIVGGTRANIIIAFSLFLFIGIVRGWITLWMLAAAGVFG 235 Yersinia...
goetting:EBL_c37910 157 ALKRFFYFFIPAMLVVYFLNPTFKMWLFFLASTVAFGFLTYVIVGGTRANIIIAFALFLFIGIVRGWISLWMLASAGAAG 236 Shimwell...
Q329X2              157 ALKRFFYFFIPAMLVVYFLRQDSKAWLFFLVSTVAFGLLTYMIVGGTRANIIIAFAIFLFIGIIRGWISLWMLAAAGVLG 236 Shigella...
WP_013319850        156 ALKRFFYFFIPAMLMWYFLHQTRRAWLIFLLTTVAFGGLTYLLVGGTRANIIIAFALFLFIGLQRGWIAWWMLAAAGGGG 235 Dickeya ...
Q2NQC5              156 ALKRFFYFFIPAMLLIYFLQPTRRRWIIFLITTVAFGIFTYLVVGGTRANIIIAFALFLFIGIQRGWITLWMLAGAGVVA 235 Sodalis ...
ACR67360            238 VVGMFWLALKRYGLAVSGDEAFYTFLYLTRDTFSPWENLALLLQHYTQIDFQGLAPIARDFYVFIPGWMWPDRPHLVLNS 317 Edwardsi...
Q8ZAF1              236 IVGMFWLALKRYGLDVNGAEAFYTFLYLTRDTFSPWENLGLLLQNYDKIDFQGLAPIVRDFYVFIPSALWPERPDLVLNT 315 Yersinia...
goetting:EBL_c37910 237 VVGMFWLALKRYGLNVSGDEAFYTFLYLTRDTFSPWENLGLLLQNYDKIDFQGLAPIVRDFYVFIPSWMWPSRPGIVLNT 316 Shimwell...
Q329X2              237 IVGMFWLALKRYGMNVSGDEAFYTFLYLTRDTFSPWENLALLLQNYDNIDFQGLAPIVRDFYVFIPSWLWPGRPSMVLNS 316 Shigella...
WP_013319850        236 IVAMFWLALKRYGLDVQGEEAFYTFLYLTRDTFSPWENLAMLWQHLDQITLQGLAPIVRDFYVFIPAWLWPDRPALVLNS 315 Dickeya ...
Q2NQC5              236 IGGMFWLALKRYGLNVSSDEAFYTFLYLTRDTFSPWENLALLLQNYGHIDFQGLAPIVRDFYVFIPGWLWPDRPSLVLNT 315 Sodalis ...
ACR67360            318 ANYFTWQVLDNHSGLAISPTLIGSLVVMGGAAFIPLGAIAVGLIIKWFDWLYTRGCTASNRYRGAVIQAFCFGAVFNMIV 397 Edwardsi...
Q8ZAF1              316 ANYFTWDVLDNHSGLAISPTLIGSLVVMGGVLFIPLGAIVVGLIIKWFDWLYEQGKAESNRYKAAILQSFCFGAVFNIIV 395 Yersinia...
goetting:EBL_c37910 317 ANYFTWEVLNNHSGLAISPTLIGSLFVMGGPWLLAPGAVVVGLIIKWFDWIYLRANQTPNRYKAAVLYSFCFGAVFNMIV 396 Shimwell...
Q329X2              317 ANYFTWEVLNNHSGLAISPTLIGSLVVMGGALFIPLGAIVVGLIIKWFDWLYELGNRETNRYKAAILHSFCFGAIFNMIV 396 Shigella...
WP_013319850        316 ANYFTWEVLNYHAGLAISPTLLGSLLIMGGPLLIPAGAVAVGLLIKGFDALYRYGRQAENRYLSAVLQAFCFGAVFNLIV 395 Dickeya ...
Q2NQC5              316 ANYFTWEVLVNHSGLAISPTLIGSLVVMGGVGFIPLGAVVVGLVIKGFDTLYERGKAAGDRYRASLLQSFCFGAVFNMIV 395 Sodalis ...
ACR67360            398 LAREGLDAFVSRVVFFCIIFGCCLLLAKLLYWLFDAAGLIRART--AIAAPSV 448 Edwardsiella ictaluri 93-146
Q8ZAF1              396 LAREGLDSFVSRVVFFCVIFGACLVLAKLLYWLFDTAGLIKRQGikSNRLSTP 448 Yersinia pestis
goetting:EBL_c37910 397 LAREGLDAFASRVVFFMVIFGLCLLVAKLLYWLLDSAGLVHARS--SAMLRRS 447 Shimwellia blattae DSM 4481 = NBRC ...
Q329X2              397 LAREGLDSFVSRVVFFIVVFGACLMIAKLLYWLFESAGLIHKRT--KSSLRTQ 447 Shigella dysenteriae Sd197
WP_013319850        396 LVREGLDAFVSRVVFFCLVFAVCLLAAKLLYWLLLRAGAVAARA--PSQGETE 446 Dickeya dadantii
Q2NQC5              396 LAREGVDAFVSRVVFFCLIFGLCLLVAKLLFLLFRHAGFIRPRT--AGLNDYN 446 Sodalis glossinidius str. 'morsitans'
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap