Conserved Protein Domain Family
DUF1265

?
pfam06887: DUF1265 
Protein of unknown function (DUF1265)
This family represents a conserved region approximately 50 residues long within a number of proteins of unknown function that seem to be restricted to C. elegans. The GO annotation for this protein indicate that its a protein involved in nematode larval development and has a positive regulation on growth rate.
Statistics
?
PSSM-Id: 369125
View PSSM: pfam06887
Aligned: 13 rows
Threshold Bit Score: 71.2464
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003095066 320 EELIKNREDFLYVCNLLIIADDSQFSNIVNCCLATIISYHFHQFMKT 366 Caenorhabditis remanei
CAP24887     271 EELVKNREDFMYVVNLLIVAEDAQFSNVQNCCVATINFYHFHDFVRN 317 Caenorhabditis briggsae
Q20266        30 EELVQNYEDLHYIKQMLLVTHNSRITTLLGSCQATIISFHFDDFIKD 76  Caenorhabditis elegans
EFO90126     299 EELVKNHEDLEYVKNVLLVAHNNRLGSLQEACHACIITYHFADFQRD 345 Caenorhabditis remanei
1_pfamImport   1 EELVKNHEDLAYVKRMLIMAHNGRLGSLLEACHAVIITSHYTDF--- 44 
CAP24888     314 EELIKHHEDMMYVKHMMLVAHNHKLGSLLEACHATIITYHLADFYRD 360 Caenorhabditis briggsae
Q9N4M1       297 EELILNCEDMAYVKELMLMAHTNRLDSLHEACNATIISFHFADFCRD 343 Caenorhabditis elegans
2_pfamImport   1 EELVKNHENFMYVCNMLLIAEDAPFVNIQNCCVAVLIHYHFNEFVR- 46 
Q19454        45 EELKKNHEDLMYVCNLLIVSEDSHFHRVENCCIATLVFYHAHDFIRI 91  Caenorhabditis elegans
Q22522       224 EELKTNYEELMYICNLLILAEDAKFQNVKNCCVATLVFYHFQDFMRI 270 Caenorhabditis elegans
Q9N4U6       240 lELQTNYEDLPYVCNLMIIAEDAKFRNVETCCIATIVSYHAHDFIRT 286 Caenorhabditis elegans
CCD31042     201 EELKKNHGDLEYVCNMLIVAEDAKFPNVQSCCIATLVYYHFNDFMRI 247 Caenorhabditis elegans
O45002       108 EELQKNYEDIMYVCNMLIIAEDAHFTNVQSCCIATLVFYHVRDFIRI 154 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap