Conserved Protein Domain Family
DUF1262

?
pfam06880: DUF1262 
Protein of unknown function (DUF1262)
This family represents a conserved region within a number of proteins of unknown function that seem to be specific to Arabidopsis thaliana. Note that some family members contain more than one copy of this region.
Statistics
?
PSSM-Id: 399693
View PSSM: pfam06880
Aligned: 32 rows
Threshold Bit Score: 113.109
Threshold Setting Gi: 550309290
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_009391265  23 EGPGSGYLLLQDEELQPASTCCWGACkcDPDRIQQLPFPQNKILTL--------SYseqrGETTDTY--GSAALFIPVPN 92  wild Malaysian ...
NP_172807     23 EGPNSGVLVIQDEESRPTLKCCFVNS--FDWELNGLPFPQNTRVIV--------KRqigtA----LY--LDPVAFIPVLH 86  thale cress
EFH69015      23 EGPNSGVLVIQDQESQPT--CCFGKC--FGCDLNGLPFPQNTRVTV--------KYqighGDDRIVL--LDSVAFIPVLH 88  Arabidopsis lyr...
XP_002892752  19 ESPNSGVLIIQDDESKPT--CCFGSC--YEAKLKGLPFPQNAKLSVyesrtfleKTlthlLSQSITYvpVEPVVFIPVLD 94  Arabidopsis lyr...
CDY26653      23 EGPNSGVLIIQDEESKPT--CCFGSC--YGSELKGLPFPQNAKLTV--------NYiiaaNNTTIVY--QDPVVFIPVLD 88  rape
XP_002892755  23 EGPNSGIMVIQDEESQAT--CCFGSC--YEGRLKGLPFPQNVKLNV--------AYtsggGEHQTTH--LTPVVFIPVLD 88  Arabidopsis lyr...
XP_002892757  23 EGPNSGILVIQDQDSQTRVTCCFSSWlvVDSSLSGLPLPQNLKLAV--------TFniggDDST-----RDPVVFIPVLD 89  Arabidopsis lyr...
XP_013677813  23 EGPSSGVLVIHDQHSQIQSTCCFGSCevVECNHSGLPLTQNLKLAV--------LFnsggDDST-----NDPIVFIPVLD 89  rape
XP_020866964  23 EGPNSGVLVIQDEDSKPT--CCFGTC--YDGELKGLPFPQNAKLTV--------TYrtgtGNDRRSY--HDPVLFIPVLD 88  Arabidopsis lyr...
OAP18071      23 EGPNSGVLVIQDEESLTT--CCFGLC--NEIFLRGLPFPQNAALTV--------RRdd-gGQNNTVH--RDPVVFIPVLG 87  thale cress
XP_009391265  93 QPLSTNRYYVITAKGKHKGKAYTCS-KEEDMTSCCV 127 wild Malaysian banana
NP_172807     87 QPPSSNLYYVIRGSGKHTGEACVSA-KEGDRASCCF 121 thale cress
EFH69015      89 QPPSSNLYYVIRRRGKHAGEACVSA-KEGDRVSCCL 123 Arabidopsis lyrata subsp. lyrata
XP_002892752  95 QPVSSNRYYAIKGSGKHSGEASANA-KEEDRVPCCF 129 Arabidopsis lyrata subsp. lyrata
CDY26653      89 QPLSSNRYYAIKRSGKHSGEASANA-KEEDRVPCCF 123 rape
XP_002892755  89 QPLSSNLYYVIQRRGKHTGKASASA-KEEERVSSCF 123 Arabidopsis lyrata subsp. lyrata
XP_002892757  90 KPLSSNCYYAIKRHGKHSGEASGSA-KEEDKVSCCF 124 Arabidopsis lyrata subsp. lyrata
XP_013677813  90 KPLSSNCYYAIRRRGKYSGEASTSA-KEEDIVSCCL 124 rape
XP_020866964  89 QPYYSNRYYVIKRRGKQSGGASASA-KEEDRVPCCF 123 Arabidopsis lyrata subsp. lyrata
OAP18071      88 QPLSSNRYYTYERCGYYSRESSTSTeKEVERVTCCF 123 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap