Conserved Protein Domain Family

pfam06854: Phage_Gp15 
Bacteriophage Gp15 protein
This family consists of bacteriophage Gp15 proteins and related bacterial sequences. The function of this family is unknown
PSSM-Id: 399679
Aligned: 19 rows
Threshold Bit Score: 156.324
Threshold Setting Gi: 503540195
Created: 11-May-2020
Updated: 7-Aug-2020
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
WP_010738474       76 s-tyiNTEE--DE-IETDRLGNPL-Pkkptk-----htkliDLVQDAKYIYASFRQ-IGINLFEE-QGKLSWEEFQALLE 143 Enterococc...
Q9A0N1             73 --nfiDAER--PEKPQLDIKGNPM-Pvvkeke---dnkkviDLSLDAEFIYASFRQAYQINLLKE-QNRLSWIEFKALLN 143 Streptococ...
CCO12054           82 -----------KEKIALDRNGDPM-Pvvkee-----nkqvYSIKHDAEYIFSSFKQAYDIDLIEE-QGKLHWDKFRAYLI 143 Carnobacte...
WP_013774271       83 meentVYKQtpVDKTRF-----------------------FSYSKDAEAIYASFYKEYKIDLVKE-RGKLHYLKFSALLD 138 Melissococ...
BAO08047           80 -----------KPKPRYDKKGNQLkPkmkei-----adqhFSFDYDAPNIYAAFYQSYGIDLFEE-RGKMRWEKFIALFG 142 Enterococc...
WP_010075235       74 -----CGKDetSLKGTGSNKTN----------------QIYSYEYDEDYIYSAFLDQYGVDLQDI--EFLHWWKFKAMFK 130 Clostridiu...
Q8Y4Z1            159 SLRDDTTIKTIIGIRQAELPSgKGTEKERNELIKLKNRYKL 199 Listeria monocytogenes
WP_016356495      146 SLSDNTKFKKIIEIRQMEETK-EMSSEQKEELRKAKKAYAL 185 Carnobacterium maltaromaticum
WP_010738474      144 SLPDDTVLAKIIQIRTWK-PSkGESTEEKARMKELQKKYAL 183 Enterococcus hirae
Q9A0N1            144 ALPDDTVMQRIIAIRQWE-DDgEGSKKYRDNMRKLKAKYSL 183 Streptococcus pyogenes serotype M1
CCO12054          144 GLPTDTKFQQVMDIRQREMPKgKGSEKERKELKKLKELYAL 184 Carnobacterium maltaromaticum LMA28
WP_013774271      139 GLSEESYFKRIIKIRKAN-PA-DYEGEDLTELIQAQQYYAL 177 Melissococcus plutonius
BAO08047          143 GLPDETRFRQIVSIRTRKMPTgKGNKEAKDELRKLKKLYAL 183 Enterococcus mundtii QU 25
CCZ35682          139 SLPDDCKIRKIMYWRTCDTSG--MARKEVQRINELRKAYEL 177 Firmicutes bacterium CAG:646
WP_010075235      131 SLKEDNEIVKIMGYRAMDLSK-IKDKSQRDFYKKAKEIYKi 170 Clostridium cellulovorans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap