Conserved Protein Domain Family
DUF1248

?
pfam06852: DUF1248 
Protein of unknown function (DUF1248)
This family represents a conserved region within a number of proteins of unknown function that seem to be specific to C. elegans. Note that some family members contain more than one copy of this region.
Statistics
?
PSSM-Id: 369108
View PSSM: pfam06852
Aligned: 9 rows
Threshold Bit Score: 256.919
Threshold Setting Gi: 74966785
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9N5J3        28 NDDVDVLTNPSDEYVDSFMKYHGNGRAVFKREDLAQWRDSFPD-YKFKVISLKGAPRVIATAHLCTFRPIDPSIN-KSIM 105 Caenorhabditis ...
CAP33395      51 RRNLEIVIDPNEKLIDAFMDGYGKQRLNFRREDIAMWRETFKDnYRLVFTVFKGTNTVIATTHAITFNPLPNHKD-TPHQ 129 Caenorhabditis ...
O02226        40 IHNVDFVIDPDEKMVDEYMKVYGNQRLNFKRNDIDIWRKSFKDsYSLWLVCLKGTNKIVQMSHVLNFPPLPSHND-ILHQ 118 Caenorhabditis ...
Q9NAR2        39 LQNVDFIINPDEKMIDEYMKVYGNQRLNFKRNDISMWMKSFEGrYALWFTCPKGTNKIIQTSHVITFPPIPSNND-TNHQ 117 Caenorhabditis ...
O62374         3 KDDVDLLTNPGEDYVDALMKWHGDERPVFKKEDIYRWKDSFPE-YRLKMVCLKDTTRVIAVGHYCYFNALKEG-Q-KPLF 79  Caenorhabditis ...
Q22958        34 RDDVEYLQNPSEEYVDAFMKWHGNSRTVFKKDDIAQLQDSFPD-YKFKMFSLTGTTRPIITMHTCKHHPLNES-K-KPFV 110 Caenorhabditis ...
XP_002630826  26 LEDYDVVINPNSQLFNKFMDEHGAKRFDFKAEDYTTWKTAWGEdYRLGLFFLKGSENLAFSFHTIHYKSLGLLPD---FR 102 Caenorhabditis ...
Q20811        26 LDDYDVVINPDDNLFEVFMQEQGNGRFDFKKEDYSTWKSSWGDaYRFGLILLKGTESIAYSFHTIQYKSLGLQPD---FR 102 Caenorhabditis ...
Q23414        22 SNNIQVIKNIQDREYEAIWKTIGSTRSDLKKDDIKKFKEAWGNdYHQTLTFLKDSDRLIASNSHVVFRPLKDSKGlENLV 101 Caenorhabditis ...
Q9N5J3       106 FMGFGWIDPGFRSPGTAKLQNDMCRVEMDR-EDDNIVSQINQPAKNFWHKLSKrkeFLDLGHkagdVGYKTFYSAHDVVL 184 Caenorhabditis ...
CAP33395     130 YLGFYWIHPDYRGVDSMRMTEYIVKKNSKC-VSDNAVAQSFPTSLKLWGKMYG---HRNYGH----IQSVSYYEMNEMKV 201 Caenorhabditis ...
O02226       119 YHGFFWIDPDYRGKDSMEIMDYIEKLRARN-QSDNNVGTYLPPAANMIKKIYG---TNNYQH----IMYVSYYKPDEMQI 190 Caenorhabditis ...
Q9NAR2       118 YRGMFWIDADYRGVDSMILTDYIEKLRIRN-QSDNAVAQCMPTSMNLWKKMHG---QNDAGH----IQNVSYYKPDEMQV 189 Caenorhabditis ...
O62374        80 FLGLGWTGPEYRTRAVMELQASMAMEERERyPTANAASHPNKFMKRFWHIFNGhkeHEDKGHkavnVTYISTFNSKDIII 159 Caenorhabditis ...
Q22958       111 FIGLGWIDPEFRSRATAKFFDSLATEELKT-KDDELMAWGNQEVRRFWHKLIGkkeHDDIGHqameVGYKSFYSGKDVTV 189 Caenorhabditis ...
XP_002630826 103 HLGIAWIPEKYRGKEILKVVTDYLIQEEQM-KKQNMLACNVHWSQNFWKRATG---KSDISAc---TYYISYYEMSDFKI 175 Caenorhabditis ...
Q20811       103 HLGMAWVPEKYRGKSILKVVTDYLIQEERM-KHQNMLACNVHWSQNFWLKATG---RSDIGAc---TYYISYYELYDFKV 175 Caenorhabditis ...
Q23414       102 FRGNLWISPDVRGSEIMDITDKQSYDVGFS-VGNNSMAYATKKTMDQYKNLTG---SMDHLH----KYYVSNYDFGDLCI 173 Caenorhabditis ...
Q9N5J3       185 PENLDLSG---ITVKNAREVPKRDIINYDQTI 213 Caenorhabditis elegans
CAP33395     202 PEDLDTSG---IIIKNARDVPDKDIVDYDNTV 230 Caenorhabditis briggsae
O02226       191 PEDLNLDG---IFLKNATEVPDMDIVKYDNTV 219 Caenorhabditis elegans
Q9NAR2       190 PDDLNLDG---IFLKNATEAPNMYIVKLLNLL 218 Caenorhabditis elegans
O62374       160 PEDLDFSG---ITVTDAREVPKRDIINYGQTI 188 Caenorhabditis elegans
Q22958       190 PEKLDANG---ITVKNAREVPKKDIINYDQSI 218 Caenorhabditis elegans
XP_002630826 176 PKVSEMKKd--VVVKTVNTETVHDVLKYDRAI 205 Caenorhabditis briggsae
Q20811       176 P-IPKIKDdceIVVKNVNTKTVTDVLKYDTSI 206 Caenorhabditis elegans
Q23414       174 PKDLDTSG---IVVKNARDVPDTDILKYDAKV 202 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap