2PBZ,2R85


Conserved Protein Domain Family
DUF1246

?
pfam06849: DUF1246 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF1246)
This family represents the N-terminus of a number of hypothetical archaeal proteins of unknown function. This family is structurally related to the PreATP-grasp domain.
Statistics
?
PSSM-Id: 399676
View PSSM: pfam06849
Aligned: 73 rows
Threshold Bit Score: 154.564
Threshold Setting Gi: 146387714
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2PBZ_B             5 VSTIASHSSLQILLGAKKEGFKTRLYVSPKR-RPFYSSL-PIVDDLVVAEEXTSILND---------DGIVVPHGSFVAY 73  Thermococcu...
jgi:Pyrfu_0237    18 IAVIGSHSALQILAGAKREGLCTVLLVREDL-APLYERFpWLYDYMLKLRSWSEIASGtiveklrslNAILVPHAGLVEY 96  Pyrolobus f...
CBRAS:FFONT_0568  17 IATLASHSSLQIVHGAKKEGFKTALITLHDR-EHFYRNFeNLIDHLIVVNSWNEICTEkvekkleslNSIFVPHGSLVEY 95  Fervidicocc...
WP_012608199      17 IGTLASHSALQIMHGAKKEGFTTILVALRDR-AWFYRDFdHLIDLIIEVNSWRDICKPeiveelrgyNTILVPHGSFVEY 95  Desulfuroco...
jgi:Igag_0273     18 IATLASHTSLQIVHGAKLEGFKTIVIVLRDR-LWFYEQFkHLIDEYIVVDSWRDVCSKnvvsrlresNAVMVPHGSYVEY 96  Ignisphaera...
jgi:Vdis_0677     15 IATLASHSSLQIFHGAKLEGFGTVAIVPRDR-LWFYEQFrHLIDHFIVLNNWRELCSPdvvrklqslNAILVPHGSYVEY 93  Vulcanisaet...
BAJ49492          11 VATVASHTALQLLRAAKKTGFRTAAICLTDN-KPFYEKF-GFIDEIYTASVDT---LDklapkltehNTVFIPHGSFVEY 85  Candidatus ...
A8M9J5            17 VVTIASHSSLQILRGAKRHGLGTVAVAKPGS-GWFYRRF-NFIDNVIEIDLGS---MEqlagdlvknNAILIPHGSYVEY 91  Caldivirga ...
Q8ZYV1            21 ISTVASHTALQILRGAKKYGFRTIAVARGEAvAQFYRQF-PFIDEVWVGDFAN---FRktaeklaanNAVFIPHGSYVEY 96  Pyrobaculum...
CCC81208          16 VATIASHTALHILRGAKLYGFRTIAVARPNT-AWFYRQF-QFIDEVWEADFSN---FRpvaerlsrqNAVLVPHGSYVEY 90  Thermoprote...
2PBZ_B            74 LGIEAIEKAKARFFGNRRFLKWETTFELQDKALEGAGIPRVEVV 117 Thermococcus kodakarensis KOD1
jgi:Pyrfu_0237    97 VGVERAEKLEVPIHGNRGLFRIEADQHSKMRLLVDAGIPTPRVY 140 Pyrolobus fumarii 1A
CBRAS:FFONT_0568  96 VGIKCAESFKIPYFGTRKMFRIEADQYKKMSLLYQAGIPIPKEY 139 Fervidicoccus fontis Kam940
WP_012608199      96 VGLECGESINVPLFGTRSLLRVEADQKLKMLLLMKAGIPTPRVY 139 Desulfurococcus amylolyticus
jgi:Igag_0273     97 IGLDCAENIEVPIFGLRGLFRVEADQHLKMDLLKKAGIPIPKIY 140 Ignisphaera aggregans DSM 17230
jgi:Vdis_0677     94 VGLDCAEGIELPIFGLRGLFRVESDQWAKMDLLRRAGIPIPRLF 137 Vulcanisaeta distributa DSM 14429
BAJ49492          86 CGPEKAQSFKVPFFGTRQLIEVEADQRRKMMLLREASIPTPEEY 129 Candidatus Caldiarchaeum subterraneum
A8M9J5            92 VGWRRALSMPIPTFGNRYIIEWEADQRKKMRLLEYAGIPIPRSF 135 Caldivirga maquilingensis IC-167
Q8ZYV1            97 VGWRQALEAPVPTLGCRELLRWEADQFKKMSLLEKAGIPIPRIY 140 Pyrobaculum aerophilum str. IM2
CCC81208          91 VGWRQALEAPVPTLGVRRLIEIEADQFKKMGLLERAGIPTPRVY 134 Thermoproteus tenax Kra 1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap