Conserved Protein Domain Family
Disaggr_repeat

?
pfam06848: Disaggr_repeat 
Disaggregatase related repeat
This family consists of several repeats which seem to be specific to the Methanosarcina archaea species and are often found in multiple copies in disaggregatase proteins. Members of this family are also found in single copies in several hypothetical proteins. This repeat is also known as DNRLRE repeat and is predicted form a mainly beta-strand structure with two alpha-helices [Adindla et al. Comparative and Functional Genomics 2004; 5:2-16]. It is found in some cell surface proteins.
Statistics
?
PSSM-Id: 399675
View PSSM: pfam06848
Aligned: 21 rows
Threshold Bit Score: 301.578
Threshold Setting Gi: 74529669
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8TS48          617 DNRLREASPDTVYKSSSFIDVGSisGVGRYRDAIQFDLSEYNSDSQITNAVLSLYWYYPSGTTRPEDTVIEIYRPaSAWN 696  Methanosarc...
WP_015313984    620 DNRLRESSPSTIFSTITYLDVGK--STSGCRDLLLFDLSAFEPTDTISEATLDLYWYYPESTTRSADTVVEVYRP-KEWD 696  Methanometh...
jgi:Metho_1817  513 DNNLRESSSCSVLGTTTYLDVGN--NESRARDVMLFDLSMYDKNDTISRATLSLFWYYPESKTRTSDTVVEVYRP-AQWN 589  Methanometh...
WP_015313872    425 DNRLRQSSPNTVLSSTAYLDIGK--SAYRCRDVMLFDLSMYNNT-TISKATLSLYWYYPAGATRTSDTVVEVYRP-MQWD 500  Methanometh...
Q8TRW0          603 DNRLREASPDTVIQNKPFIDVGGtdNVGRYRDVMWFNLSEYSD-QKISKAIISLYWYYPE-ESRPEDTVIEVYRP-ASWN 679  Methanosarc...
Q8TNA9          612 DNRLREASPDIVYQSSPFIDVGAm-SIGSYRDIMWFDLSVYADYSEVNSATLSLYWYYPAGKARPEDTVIEIYRPaDSWN 690  Methanosarc...
Q8TLE9          533 DNRLREASPYITYQEKAYIDIGGrpGVGRYRDLILFDLSKYDDAENITSATLSLYWYYPDGRARPEDAIVEIYRPaAAWD 612  Methanosarc...
Q8THS0          410 DNRLREASPDVVYQDKVYIDIGGrpGVGRYRDLILFDLSKYDEAENITNATLSLYWYYPDGIERPEDTIVEIYRPaAAWS 489  Methanosarc...
Q8THR8          515 DNRLKEEAPNTTYRETEYIDVGErpGGGIYRDVMLFELKQLDETDSIEKATLSLFWYYPE-EARPEDIVLEVYRP-EKWC 592  Methanosarc...
WP_015325153   1840 DNILSESSSCVVFSDTSYLAVGK--SKARSRDVMLFDLSMYNKDDTISKATLSLFWYYPAGQTRTSDTVVEIYRP-QRWD 1916 Methanometh...
Q8TS48          697 SSYVSWNKRDKNVAWTNEGGDWYDRNGVLQGSTPYATITIKGSSLPDNRYYELDVTDLVKEYVSGKYENTGLLIKARTES 776  Methanosarc...
WP_015313984    697 PNYVSWNNRISGTAWTTAGGNWYDNNGIAQGSTPYASIKFPASTIPDNKYYQFDVTELVQEYIQGNYNNTGFYLKAKTES 776  Methanometh...
jgi:Metho_1817  590 PEHVTWYYYDYHRAWQPVGGAWFDVNNIAQGNVPYASVTFPASTVPDNQYHDFDVTQLVQEYISGTYENTGFFLKASTES 669  Methanometh...
WP_015313872    501 PQYVTWNSRMSGTPWDTAGGNWFDKNGVDQGTTPYASVTFPASVVPDNRYYEFDVTELVQEYVSGDYDNTGFFLKAKTES 580  Methanometh...
Q8TRW0          680 PSYVSWNNRDNGVKWTNAGGDWYDKEGVSQGNTPYAKFTIKGKELPDNRYYELDITDLVKEYVSGEYENTGFLIKARSES 759  Methanosarc...
Q8TNA9          691 PDYVSWNKKDKRVAWNNAGGDWYDRNGVLQGSTPYATITLEGSDLPDNRYYELDVTDLVNEYISSKYENTGFLIKARTEN 770  Methanosarc...
Q8TLE9          613 PQSVTWNSRGDCVPWTYPGGDWFDKDGILQGDDPYATITLKGCSLPDNRYYEINVTELVKEYASGKYENTGFLVKTRTED 692  Methanosarc...
Q8THS0          490 PENVTWNSRDTGVLWTQPGGDWFDMNNTSQGDAPYATITLKGSDIPDNRYYELNVTELVKEYVSGEYENTGFLIKTQNEN 569  Methanosarc...
Q8THR8          593 EEHVTWEEREIETPWQNPGGDWYDRNDVLQGSMPYATITIKGSTLPDNRYYELDVTELVKEYVSGEYENTGFLIKARSES 672  Methanosarc...
WP_015325153   1917 PKHVTWYYRLYRTAWNPVGGAWFDKNGVSQGSTPYASVTFPASTVPDNQYHDFDVTQLVQEYIRGTYENTGFFLKARTES 1996 Methanometh...
Q8TS48          777 NNYIAFYSSDWTDENQKPKITV 798  Methanosarcina acetivorans
WP_015313984    777 NNYIAFYSSEWSNTSQRPKLTI 798  Methanomethylovorans hollandica
jgi:Metho_1817  670 GNYIAFYSSEWSNPDQRPKLTV 691  Methanomethylovorans hollandica DSM 15978
WP_015313872    581 SNYIAFYSSDWSNADQRPKLTI 602  Methanomethylovorans hollandica
Q8TRW0          760 NNYIAFYSSDCGNESQEPKLKI 781  Methanosarcina acetivorans
Q8TNA9          771 NNYIAFYSNDCGNENQKPKLTV 792  Methanosarcina acetivorans
Q8TLE9          693 ADYIAFYSNEGGNESQRPRLNV 714  Methanosarcina acetivorans
Q8THS0          570 ADYVAFYSSDIEDKDKRPTLNI 591  Methanosarcina acetivorans
Q8THR8          673 SNYIAFYSSEWQNKAQRPKLTI 694  Methanosarcina acetivorans
WP_015325153   1997 GNYIAFYSSEWSNADQRPKLTV 2018 Methanomethylovorans hollandica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap