Conserved Protein Domain Family
Phage_fiber_C

?
pfam06820: Phage_fiber_C 
Putative prophage tail fibre C-terminus
This family represents the C-terminus of a prophage tail fibre protein found mostly in E. coli. All family members contain a conserved RLGP motif.
Statistics
?
PSSM-Id: 148432
View PSSM: pfam06820
Aligned: 2 rows
Threshold Bit Score: 104.234
Threshold Setting Gi: 123858685
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
nankaitd:CDCO157_2511 365 IRFRLGPASIIETNSHGWFPGTDgALITGLTFLaPKDTTRVQGFFQHLQVRFGDGPWQDVKGLD 428 Escherichia coli Xuzhou21
Q6H9S8                 68 AQLRLGPADILESDENGIIPEQD-RVITQVVIL-DADKKQIQCVVRPLQILRADGRWENIGGMK 129 Enterobacteria phage B...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap