Conserved Protein Domain Family
Arc_PepC

?
pfam06819: Arc_PepC 
Archaeal Peptidase A24 C-terminal Domain
This region is of unknown function but is found in some archaeal pfam01478. It is predicted to be of mixed alpha/beta secondary structure by JPred.
Statistics
?
PSSM-Id: 399657
View PSSM: pfam06819
Aligned: 8 rows
Threshold Bit Score: 110.945
Threshold Setting Gi: 297378722
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_023992309  239 ILFVSINIVKTVIKLLGSVSKKALQDDVPLDKLREGMIPAYNVYQQDDDEIFVDDKSFTQKLKESFKnKDPSLITtpqGK 318 Methanobacteri...
Q6M0N8        209 SFFVYIGQLSLISLVIYALTGAEISSKKQISDLKEGDIIRDIVTIKENGEVTVENANILKRFKHMIY-GEMGKLE---GK 284 Methanococcus ...
jgi:Maeo_0935 209 QFLVYVGELSLISIVIYALTGAEISSKKLVKDLKEGDILRDIITIEGN-SVTVEGANILKRFKLMVD-AEMGKNEtenKK 286 Methanococcus ...
Q5JED9        255 KVLATIYAVKVLLSTAKILRGKVLVEEVPVEELHEWDILGETIHEL-NGEVKREREGTIERFKRALStWDFSEIRpkvGR 333 Thermococcus k...
Q8U3J5        254 RLVIILYAFKLLLSSVKMLRKEVLTKVKRVEELKEGEVLGERILEV-GGKIVRDRKDFFEKLNEVLKsGKFEQIS---GK 329 Pyrococcus fur...
O26521        240 ILWVSITVIQLIRKLLTSITREALQDTMGVDELKEGMILASTLYRK-GDEYYFDDSSLLDRFRTAARtGDVSALTy-rGE 317 Methanothermob...
jgi:Mvol_1220 205 NYAVYGLELSLLSVVIYALTGAEISIKKPISELKEGDIIRDIIIINGD-NVSVNNSSLFKRIKIMFN-AQIGKIE---GK 279 Methanococcus ...
P81324        207 TSIIYLCEIILISIVIYALTGVETSDKKHIEELKEGDILRDVIIIDKDG-VEVKNLNIMKRIKFLLE-HEIKENE---KE 281 Methanocaldoco...
WP_023992309  319 RLVGTlAAGLTDKDIDLLKKLNQEDKIPDEFRI 351 Methanobacterium sp. MB1
Q6M0N8        285 SLMTD-GEGLSDENLELLNKLQNEGKIGGELNV 316 Methanococcus maripaludis
jgi:Maeo_0935 287 ILMTD-GEGLYKEDLELLQKLHKEGKIPNELNl 318 Methanococcus aeolicus Nankai-3
Q5JED9        334 VVASPtAEGLTKEQIEELKKLVEEGKLENRF-L 365 Thermococcus kodakarensis KOD1
Q8U3J5        330 EIAGFsVEGLTKEQIEELKKLVSEGKLENEFLV 362 Pyrococcus furiosus
O26521        318 PVVSAmAAGLREEEIETLRDLVSRGKIKDEFRI 350 Methanothermobacter thermautotrophicus str. Delta H
jgi:Mvol_1220 280 VINLD-GEGLSNEDIDLIKDLNSKGKITDvnil 311 Methanococcus voltae A3
P81324        282 IILTD-GEGLSNEDIRKIKKLYMEGKIPDKLNV 313 Methanocaldococcus jannaschii DSM 2661
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap