Conserved Protein Domain Family
RVT_thumb

?
pfam06817: RVT_thumb 
Reverse transcriptase thumb domain
This domain is known as the thumb domain. It is composed of a four helix bundle.
Statistics
?
PSSM-Id: 399655
View PSSM: pfam06817
Aligned: 17 rows
Threshold Bit Score: 81.5922
Threshold Setting Gi: 77416881
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P18096         852 LQKLQLPQKDIWTVNDIQKLVGVLNWAAQIY--SGIKTKHLCRLIRGKMTLTEEVQWTELAEAELE 915  Human immunodeficiency vir...
8_pfamImport     1 LQRNIIKPQKKIILNDFQKLSGDINWLQPSLgiTSHSLTHIFQVLQGESDLNRPCVLTEQAKQKLD 66  
10_pfamImport    1 PQKVQIRRDNLKTLNDFQKLLGDINWLRPMLgiPTHQLRHLFSTLEGDTALNSPRSLTSQAKEELH 66  
4_pfamImport     1 PQKLQIRRDHLKTLNDFQKLLGDINWLRPVLgiPTYQ----FSTLEGDTALDSPRTLTPLALQELQ 62  
5_pfamImport     1 PQKSQIRRGHLKTLNDFQKLLGDINWLRPVLgiPTYQLQHLFSTLEGDTALDSPRTLIPLALQELQ 66  
P63133         252 PQKIEIRKDTLKTLNDFQKLLGDINWIQPTLgiPTYAMSNLFSILRGDSDLNSKRILTPEATKEIK 317  human
6_pfamImport     1 PQKVELRRDQISTLNDLQKLLGDINWLRPYLgiPTYELSNLFSLLRGDSKLNSPRSLTAEAEEELK 66  
AAM81191       244 PLEFEIAIDGLQTLNDFQKLCGNLNWLRPYCklTTEDMMPLFNILEGDTQLDSPRRLTKEAHLALQ 309  rabbit
7_pfamImport     1 PQQLSI-KDNPRTLRDLHSLCGSINWIRPLLgiTTKDLAPLFNLLHGKEDLDSPCTITPEGQSAIV 65  
XP_016284981   157 SHKVSLTRSTLKTLNDFQKLLGDINWLRPYLqlAKADLRPLEDILRGDADPSSPRSLTPAGEASLK 222  gray short-tailed opossum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap