3I08,2OO4,4ZLP


Conserved Protein Domain Family
NOD

?
pfam06816: NOD 
NOTCH protein
NOTCH signalling plays a fundamental role during a great number of developmental processes in multicellular animals. NOD and NODP represent a region present in many NOTCH proteins and NOTCH homologs in multiple species such as NOTCH2 and NOTCH3, LIN12, SC1 and TAN1. Role of NOD domain remains to be elucidated.
Statistics
?
PSSM-Id: 399654
View PSSM: pfam06816
Aligned: 58 rows
Threshold Bit Score: 62.8972
Threshold Setting Gi: 765127428
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3I08_A               123 ERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYG 177 
9_pfamImport           2 PRLAQGAISVVVLMDMQMFNANLVKFLRDIGHHLRATVRVKTEGDGRDMVYPWK- 55  
WGS:AAQB:GK17279-PB 1570 PQLAEGAMSIIMLMDNKEFEDQKAKFLREISYVLRTNVQIKKDSRGNDMIFMWRG 1624 Drosophila willistoni
EDV99720            1638 PQLAEGAMSVVMLMDVRQFRAEQAQFLREMSHVLRTTVRVKKDALGNDMIFSWKG 1692 Drosophila grimshawi
XP_001967548        1605 PVLAEGSMSIVMLMNVDQFRMIQAQFLRNMSHMLRTTVKLKKDAMGQDMIFNWRD 1659 Drosophila ananassae
EDW27872            1574 PQLAEGAMSVVMLMDVEQFRSLQAQFLRNMSHMLRTTVRMKKDSLGRDMIINWKD 1628 Drosophila persimilis
XP_028029735        1594 PDLAEGVMSVILLMDMKTFKENSVAFLRDLGHQLRTTVLIKKDHLGNDMVLPWKG 1648 wild silkworm
Q16TK9              1597 AQLAEGAISIILLMDMETFKKNSVQFLRDLGHQLRTTVRIKKNNAGMEMIFPWKG 1651 yellow fever mosquito
ETN64594            1106 ALLAEGAISTILLMDLTAFRAKRVQFLRDLGHHLRTTVRIKKNAAGVEMIFPWKG 1160 Anopheles darlingi
EFX69806             166 sILALGSVSMVLEMDLPTFKNMSVAFVRSIGRQLRTTVRIKLDQQGYEMVYPWNl 220  common water flea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap