Conserved Protein Domain Family
NapE

?
pfam06796: NapE 
Periplasmic nitrate reductase protein NapE
This family consists of several bacterial periplasmic nitrate reductase NapE proteins. Seven genes, napKEFDABC, encoding the periplasmic nitrate reductase system were cloned from the denitrifying phototrophic bacterium Rhodobacter sphaeroides f. sp. denitrificans IL106. NapE is thought to be a transmembrane protein.
Statistics
?
PSSM-Id: 369084
View PSSM: pfam06796
Aligned: 25 rows
Threshold Bit Score: 51.4441
Threshold Setting Gi: 122299754
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9KRE8         14 SDVNKVESGEKRSLEWKSFLFITVVLFPILSVAFVGGYGFIVWMLQMFvFGPPG 67  Vibrio cholerae
Q484F4          4 EQINKETGEKKKRKELKALGFIIVVLFPVLSVFAIGGYGLIIWLIQAF-GGVIP 56  Colwellia psychrerythraea 34H
Q8EHI7          3 KPTMQTSDKSSRSNELKALGFIIFILFPALTIAGISLYGFIIWMIQAF-GGVVG 55  Shewanella oneidensis
Q082H3          3 TKNVVDPQSNVKSKELKALGFIIFLFFPIITVTSISAYGFVIWMIQAF-GGVVA 55  Shewanella frigidimarina NCIMB 400
jgi:Shew_2796  13 SHPISEIRDQDKSKELRALGFIIVMLFPMLTITGISAYGFIIWMIQAF-GGVVA 65  Shewanella loihica PV-4
WP_013345705    1 -msRETTNAGDKGSEWRAFLIIAVFLFPVLAATFVGAYGFIIWILQMI-FGPPG 52  Ferrimonas balearica
IBRC:GU3_08885  1 mnNNSSGRASTKGREWLSLLFITLVFFPVLSIICVGGYGFAVWMLQLI-FGPPG 53  Oceanimonas sp. GK1
Q21PN3         20 EMETDPAMQVEKRQERRMFMFITIVLFPLLSVMLVGGYGLLIWVSQMI-WGPPT 72  Saccharophagus degradans 2-40
WP_011912449    5 PNDTRPSVASTKRDETRLFVFLIVFLFPILSVALVSGYGFIVWIVQMI-FGPPG 57  Pseudomonas
Q487G1          1 -mNQATSPEQQKKHERNTFIFLAVFLAPILSVIIVAGFGFAVWISQIF-FGPPS 52  Colwellia psychrerythraea 34H
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap