Conserved Protein Domain Family
UPF0262

?
pfam06793: UPF0262 
Uncharacterized protein family (UPF0262)
Statistics
?
PSSM-Id: 399643
View PSSM: pfam06793
Aligned: 50 rows
Threshold Bit Score: 212.015
Threshold Setting Gi: 161785568
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5LLF5           3 MSRISHIELDDsNLPPPTPEIEQ-ERKVAIYDLLEENSFA----LPArDdravPEGPYRVNLSIRDKRLVFDIQT-EDEE 76  Ruegeria pome...
jgi:Bresu_2245   3 DQRLASVDLDEaTLPSATAEIEH-ERRVAIFDLVEKNVFT----PEG-A----DAGPYGLKLSLQDNRLVFDITG-IDFA 71  Brevundimonas...
WP_013478698     1 -mKLARIDIDSdSLASPSPEVEH-ERQVAMFDLIEKNSFK----PEG-G----SAEKYDLRLAYEDGRLVFDVSG-EGYA 68  Asticcacaulis...
WP_013946305    12 RDRLIEITLDAkSLGRANSNIEH-EREVAIFDILDGNSFR----VED-M----NAGPYKLHLSLTEERLVLAISP-AEGG 80  unclassified ...
Q0AQL6           5 DDRIVRIDLDGaSMGPGDVNADH-ERRVAIADLLEGNRFR----PDGe-----VDGPYALRLAIEHDRLVFDVRL-EDDT 73  Maricaulis ma...
P55670           5 EFRLCDVALDc-SFKTRDQRVER-EQALAVLDLLEASTFV----PVGh-----HGGPYRLKISMAAGRLVFHIAD-DKGA 72  Sinorhizobium...
CAP55139        17 prmLAHVILDDvDDGLGAGRVRRnDVAQAIADLHQTARFV----PQG------LVGPFNLHLSVQTNGLIFDIRS-VQDV 85  Gluconacetoba...
A5FUV6           9 RGRLRRVVLDEdIGGALSPMQEA-DRNQAIADLAADNRFAlgthP---------DAVTILHLSVQDGRLVFDVRD-EADE 77  Acidiphilium ...
HuoZJU:KKY_402  10 TDRIVTVTLDPtTITSVDPDEVH-EWRVAIYDLVDTNRFY----PARvS----AKGPYALHLSIIHNHIVLDVRHpETFS 80  Pelagibacteri...
WP_013299452     2 TERLVAIDIDEgSLGARSSEVDH-ERKVAMHDLLEENRFA----PVGgE----DKGPYRLKLFEQNGRLVFDVST-EAGD 71  Parvularcula ...
Q5LLF5          77 KAAEFHLSLGPFRQVVKDYFQICESYFNAVKTLPPSQIETIDMARRGIHNEGSRVLQERLDGKAEIDTDTARRLFTLICV 156 Ruegeria pome...
jgi:Bresu_2245  72 --RTYALSLTPLKSVLKDYLMICDSYYEALRGSSASQIEAVDMGRRGLHNEGAELLKARLDGKIEIDHETARRLFTLVCA 149 Brevundimonas...
WP_013478698    69 --KKIMLSFTPLKPIMKDYAMICESYYEALKNATVGQIESIDMGRRGIHNDGAELLTERLAGKIEIDHETARRLFTLIHA 146 Asticcacaulis...
WP_013946305    81 DPVELGMALAPLKRIVKDYFMICESYYEAVRTAPPARIQAIDVSRRALHDEGSVLLKEKLLPRIVVDEDTARRLFTLVCS 160 unclassified ...
Q0AQL6          74 PVHGFMFALGPLRRIVKDYFLICESYYEAVRDAPLERIEAIDMARRGVHNEGSTLLRERLVGKIDVDFDTARRLFTLICA 153 Maricaulis ma...
P55670          73 HIVSHHLSLAPFRRLLNDYSRTCEGYYEAMCRSNLERLQAIDMGRRGIHDEAAELLRERLSAKVDIDKDTARRLFTLIYA 152 Sinorhizobium...
CAP55139        86 PLRIYRVSLTPFRRLIKDYVLLVDSFDQAVTEGNTMRIRAIDMGRRGLHNDGAALMIERLRGKIDMDEETARRLFTLACI 165 Gluconacetoba...
A5FUV6          78 TLQTLVLAPGPFRSMIRDYQMLLDSYATAVAEGREARIQAIDMGRRGLHNEGAELVMARLDGKVLLDFDTARRLFTLICA 157 Acidiphilium ...
HuoZJU:KKY_402  81 PIAAHYLSLTPFRSLIRDYFRIRESYYEAIRSASTFQIEAVDMGRRGLHNQAAELLIERLNNKLVMDLETARRLFTLICA 160 Pelagibacteri...
WP_013299452    72 PLIQHHLSMTPFRRLIKDYFMLCETYYDAIRAAMPEKLETVDMARRSVHNEATELLQKRLEGKISTDFDTARRLFTLICS 151 Parvularcula ...
Q5LLF5         157 LHF 159 Ruegeria pomeroyi DSS-3
jgi:Bresu_2245 150 LYR 152 Brevundimonas subvibrioides ATCC 15264
WP_013478698   147 LHL 149 Asticcacaulis excentricus
WP_013946305   161 LHW 163 unclassified Hyphomicrobium
Q0AQL6         154 LHR 156 Maricaulis maris MCS10
P55670         153 LLA 155 Sinorhizobium fredii NGR234
CAP55139       166 LQQ 168 Gluconacetobacter diazotrophicus PA1 5
A5FUV6         158 LHR 160 Acidiphilium cryptum JF-5
HuoZJU:KKY_402 161 VQp 163 Pelagibacterium halotolerans B2
WP_013299452   152 ISL 154 Parvularcula bermudensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap