Conserved Protein Domain Family

pfam06785: UPF0242 
Uncharacterized protein family (UPF0242)
PSSM-Id: 399636
Aligned: 7 rows
Threshold Bit Score: 172.667
Threshold Setting Gi: 31563237
Created: 11-May-2020
Updated: 7-Aug-2020
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
WP_032124842   19 RQYLSIAIIFFYLLPLL--FFASYSIGLMShhk-------------swsMLSFGL----LLIACGSLCLILLIYYWelal 79  Candidatus Pro...
unil:wcw_1947   8 RLQLSGLIIALYFASIL--IISIYPDASLL-------------------KFVFGL----FIASVGSILAFLLLRQW---- 58  Waddlia chondr...
WP_013925559    8 RHQLIGLAVALYLIPLF--VLTFMSLQHLPlsk-------------swtFLSVGL----FLSLAGSLFLLFVLKGWedal 68  Parachlamydia ...
WP_041017816    9 RQSVTISALLVYSAPLIf-VLGFSKNQTFSsw----------------tIFSIAL----LILSAASLIHLSLLFNFykne 67  Criblamydia se...
CDZ79788        7 KYKFLLIIFFVYFIPYC--SLAIYNFQYLAsed-------------lwnILSIGL----LIPIFGTLLLFYSYLTFqkn- 66  Candidatus Rub...
Q6MEU1         17 RQFFSAAVIFFYLLPLL--FFVTYSIGLMPhqk-------------swsILTLGL----LLVAIGSICLILLAYYWeigl 77  Candidatus Pro...
O84621         31 KIHYCISRYFHYLPPVLaiLLPIGSWPFLSeqqwwygsflfpvvsslgwLFAIGRrerqLRAAAGQL------------- 97  Chlamydia trac...
WP_032124842   80 keklqteqsklfhQISFNPEKENKVTSLDtshtfpqlidSEPHSIKDDikdlslletNLKESQSEQMRLEEE-------- 151 Candidatus Pro...
unil:wcw_1947  59 -------------EKSKLAEQLPLPSSPEpmqnapsfssPENIGELEQ---------ALKDAQSKNHDLIQK-------- 108 Waddlia chondr...
WP_013925559   69 ---------klyfENIYIESQKALIPETP----------AEDFAILKQ---------KVEELTEQEELLARE-------- 112 Parachlamydia ...
WP_041017816   68 ge-----gfegssEKENPDQKEAFLSEER--------------RVELE---------ELENLRAKEEELREE-------- 111 Criblamydia se...
CDZ79788       67 ----------vtlQANLIPTDQSVLQELS--------------DQNEQ---------ALLNVQEELKILQDL-------- 105 Candidatus Rub...
Q6MEU1         78 ktkwqgesailssQSSFTSEKENKVTALDpaftlvpleeAPSFTTKEEvtl----lnSLENLNDEQRKREEE-------- 145 Candidatus Pro...
O84621         98 -----------------LEAKIRKLTEQD-----------EGLKNIRE---------TIEKRQKETDRLKLHndklveql 140 Chlamydia trac...
unil:wcw_1947 109 -------------QNQLEETLHKHEQEKA---QFELKLQDIQH-------QIEAQSLEADEEIRRKTTLLSEYQETINQQ 165 Waddlia chondr...
WP_013925559  113 -------------LSQKDTELAEYQNREE---EIK-RLVQISE-------DFAEFRLEMEQQIEEREQLIHTLRQETHEQ 168 Parachlamydia ...
WP_041017816  112 -------------ISYRNEELLRLTREKEfeiSLREQLED----------DFDRFRKDSEDRLAEEKILLQEYAENISSL 168 Criblamydia se...
O84621        141 gqarevfiqakgrYDHMEELSRRLKEENQ---QLQIQLEAAVRernekilENQELLQELKETLAYQQELHDEYQATFVEQ 217 Chlamydia trac...
WP_032124842  209 RGEMEKRQDQIYQLDTKVHDLSYEIKTLLYLH 240 Candidatus Protochlamydia
unil:wcw_1947 166 REVIKKKQEQISELESKVRDLNYEVKTLLQLA 197 Waddlia chondrophila WSU 86-1044
WP_013925559  169 KIVLQSKDDRIEDLESQVNDRNYELQTLLKFS 200 Parachlamydia acanthamoebae
WP_041017816  169 RASLEERQEENERLQSKIRDMAYEIKTLVDLA 200 Criblamydia sequanensis
CDZ79788      163 RATIEKKQNYINQLESKVRDLNYEIKTLLKLA 194 Candidatus Rubidus massiliensis
Q6MEU1        203 RSEMEKRQDQIFHLDTKVHDLSYEIKTLLYLH 234 Candidatus Protochlamydia amoebophila UWE25
O84621        218 HSMLDKRQAYIGNLEAKVQDLMCELRNLLQLE 249 Chlamydia trachomatis D/UW-3/CX
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap