1VDH,6FXQ,1T0T,4M05


Conserved Protein Domain Family
Chlor_dismutase

?
pfam06778: Chlor_dismutase 
Click on image for an interactive view with Cn3D
Chlorite dismutase
This family contains chlorite dismutase enzymes of bacterial and archaeal origin. This enzyme catalyzes the disproportionation of chlorite into chloride and oxygen. Note that many family members are hypothetical proteins.
Statistics
?
PSSM-Id: 399631
Aligned: 123 rows
Threshold Bit Score: 140.349
Threshold Setting Gi: 121731576
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1VDH_E         37 REDAWEELKGLVREwreleeAGQG-SYGIYQVVGHK--ADLLFLNLRPGLDPLLEAEARLSRSAFARYLGRSYSFYSVVE 113 Thermus thermo...
4M05_D         36 RVISVAEVKGLVEQ------WSGKiLVESYLLRGLSdhADLMFRVHARTLSDTQQFLSAFMGTRLGRHLTSGGLLHGVSK 109 Nitrospira def...
WP_014235269   75 RKGAAEEVKKLIEK------HKDNvLVDLYLTRGLEtnSDFFFRINAYDLAKAQTFMREFRSTTIGKNADVFETLVGVTK 148 Azospira oryzae
jgi:Haur_3545  35 REDLREQFAQVVEE------AYPSiVTYAYSTIGFKlnSDLLLWRKGTSPIAMQEMTSRLLQTGIGAYFEQTNLYFGFTR 108 Herpetosiphon ...
Q9YFL1         32 VSEAAESSDATVSR----------------AYLNISgpGHLSLVAAFTEAGGLGRLRLELSR---WGCVEEAVWWPAYYK 92  Aeropyrum pernix
EQB67756       26 RNGVIERINSTFMD------YGKK-LINLRMYRSIRhdSDIIFWLSSSDPMDISEFRKDIML-AMSGYGIPEYSMFSLYE 97  Thermoplasmata...
EQB72567       29 RDAVVEALNVTFRE------YEGR-LINLRMYRSIRhdCDVIFWMSSHDPMDMSRFKESIMR-AMGGYGSARYSMFSLYE 100 Thermoplasmata...
BAK54746       26 RKQILSRLNEVEKE------FSNK-LVSLKRFISLRydGDIIYWACDYNTTPLNDFRYSLLS-VSNSYLEEKVSFFSVFK 97  Sulfurisphaera...
Q4JCN7         26 RRNILNRIEELEAR------SKND-LVALKRFISLRydGHLLYWVSDFDTSKLNNLRYSLIS-SGEGFLEEKLTLFSYFK 97  Sulfolobus aci...
WP_012020685   20 RAKILGLVKEVEEQ------EGKN-FISIRRYASINrsSSLVYWLSSETTTPLVKFRSSLLS-ALRGYADEDVLLFSVFR 91  Metallosphaera...
1VDH_E        114 LGSQekp--ldpESPYV-KPRLTPRVPKSG--YVCFYPMNKRRQgqdnWYMLPAKERASLMKAHGETGRKYqGE---VMQ 185 Thermus thermo...
4M05_D        110 KPTYvagf-pesMKTEL---QVNGESGSRP--YAIVIPIKKDAE----WWALDQEARTALMQEHTQAALPYlKT---VKE 176 Nitrospira def...
WP_014235269  149 PLNYiskdkspgLNAGLsSATYSGPAPR----YVIVIPVKKNAE----WWNMSPEERLKEMEVHTTPTLAYlVN---VKR 217 Azospira oryzae
jgi:Haur_3545 109 PSNY--------TKRPTtQEQAIDLEDREP--YLIVYPFSKTKE----WYLMSRDARQGMMNEHIRVGHEY-AD---VRQ 170 Herpetosiphon ...
Q9YFL1         93 ESPY--------ARSKT-AEEVVEALKNSKfrFLVAYPMKKSPT----WYLEPEEVRRRAMGEHIRIAMER-TRenpVLS 158 Aeropyrum pernix
EQB67756       98 HSPY--------LRASG-SLEDTLKFTPKK--YFVAYPMSKTPD----WYLIDYDERKKILAEHIGMATSH-PEnrdIRS 161 Thermoplasmata...
EQB72567      101 HSPY--------LRDVR-SLEDTLRFVPKR--YFVAYPMSKTPD----WYLIDYDERKRILAEHIGMATSH-PEnrdIRS 164 Thermoplasmata...
BAK54746       98 PSPY--------TMGGNkDLSSFLKIPPLK--YFVAYPMKKSPE----WYLLPFEERRDIMAEHINIAKNH-PDnegIRS 162 Sulfurisphaera...
Q4JCN7         98 PSPY--------IGGSAdKLASYLRLEPLR--YFIAYPMKKSPE----WYLLPFEERKEIMDEHIEIAKTH-PDnqgIRS 162 Sulfolobus aci...
WP_012020685   92 PSPY--------TRGNF-NPKDVLNSPPLK--YFVAYPMKKDVE----WYLIPFQEREEIMREHIKVAREH-PGnkgIRS 155 Metallosphaera...
1VDH_E        186 VISGAQGLDDWEWGVDLFSEDPVQFKKIVYEMRFDEVSARYGEFG-PFFVGKYL 238 Thermus thermophilus
4M05_D        177 KLYHSTGLDDVDFITYFETERLEDFHNLVRALQQVKEFRHNRRFGhPTLLGTMS 230 Nitrospira defluvii
WP_014235269  218 KLYHSTGLDDTDFITYFETDDLTAFNNLMLSLAQVKENKFHVRWGsPTTLGTIH 271 Azospira oryzae
jgi:Haur_3545 171 VLLYTTGIDDHEFIVAYETDSLPRFEELVIALRSTEARRYTLNDT-PIITGVNR 223 Herpetosiphon aurantiacus DSM 785
Q9YFL1        159 VTTYAFGIADYEFLVLYEVDSIPAWIETVEALRAAEARKWIIREE-PVLLGLRL 211 Aeropyrum pernix
EQB67756      162 YTTYSYGLGDQEFVVLYETDSLSQWSHVTEKLREARARKWIIKEE-PIFIGILS 214 Thermoplasmatales archaeon A-plasma
EQB72567      165 YTTYSYGLGDQEFVVLYETDSLSQWSHVTGKLREATARKWIIKEE-PIIIGILS 217 Thermoplasmatales archaeon A-plasma
BAK54746      163 YTTYSFGIGDYEFVVIYEIPDLYKWTNVVEKLREAKARKWITLEE-PILVGELG 215 Sulfurisphaera tokodaii str. 7
Q4JCN7        163 YTTYSFGIADYEFVVIYEAPDLSKWINVVERLREAKARKWVVSEE-PILVGEIG 215 Sulfolobus acidocaldarius
WP_012020685  156 YTTYSFGIADYEFVVIYEIPSLPEWIQVVEALREVRARKWITKEE-PLVTGELM 208 Metallosphaera sedula
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap