3CXB


Conserved Protein Domain Family
Sif

?
pfam06767: Sif 
Sif protein
This family consists of several SifA and SifB and SseJ proteins which seem to be specific to the Salmonella species. SifA, SifB and SseJ have been demonstrated to localize to the Salmonella-containing vacuole (SCV) and to Salmonella-induced filaments (Sifs). Trafficking of SseJ and SifB away from the SCV requires the SPI-2 effector SifA. SseJ trafficking away from the SCV along Sifs is unnecessary for its virulence function.
Statistics
?
PSSM-Id: 399625
View PSSM: pfam06767
Aligned: 5 rows
Threshold Bit Score: 639.234
Threshold Setting Gi: 75405359
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3CXB_A   1 MPITIGNGFLKSEILTNSPRNTKEAWWKVLWEKIKDFFFSTGKAKADRCLHEMLFAERAPTRERLTEIFFELKELACASQ 80 
Q8VTL5   1 MPITIGNGFLKSEILINPPGNTKETWCKVLWERIKDFFFSTGKAKADRCLHEMLFADRTPTRERLTEIFFELKALACASQ 80  Salmonella enterica
Q8VTL7   1 MPITIGNGFLKSEILITPPKKTAESWWRILWERFKDYFFSTGRAKADSYIHEMLFTDPPPTRERLADIFFELKALACASH 80  Salmonella enterica
Q8VLN2   1 MPITIGNGYLKSEIFINAPSKTREPWWKALWEALKDLFFSTGRAKADSYIHEMFFSDPPPTRERLADIFFELKGLACPSH 80  Salmonella enterica
Q8VTL2   1 MPITIGNGYLKSEIFITPPGNTREAWWKVLWEKIKDFFFSTGKAKADSCLHEMLFADSPPSRERLTEIFFELKALACASH 80  Salmonella enterica
3CXB_A  81 RDRFQVHNPHENDATIILRIMDQNEENELLRITQNTDTFSCEVMGNLYFLMKDRPDILKSHPQMTAMIKRRYSEIVDYPL 160
Q8VTL5  81 RDRFQVHNPHENDATIILRIMDQNEENELLRITQNTDTFSCEVMGKVYFLMKDRPDILKSHPQMTATIKRRYSEIVDYPL 160 Salmonella enterica
Q8VTL7  81 TDRFQVYNPHGDDSTIIFRIVDEKGGDDLLRITQSTDIFSCTIMGEIYFLMKSKPGLLKSYPQMTFTINKRYSETLKSII 160 Salmonella enterica
Q8VLN2  81 KERFQVYNPHEDDSTIIYHILDENGKDELLCIIQNTDTVHCKAMGNSYFAVREQPVCLKSYPQMTYTVNKKYSEIVESSL 160 Salmonella enterica
Q8VTL2  81 KDRFQVYNPRENDATIIFRIMDENEEVELLRITQSTDTFSYKIMGRSYFLIEDYPGILKSHPQMRLVINKRYSEVVDYPL 160 Salmonella enterica
3CXB_A 161 PSTLCLNPAGAPILSVPLDNIEGYLYTELRKGHLDGWKAQEKATYLAAKIQSGIEKTTRILHHANISESTQQNAFLETMA 240
Q8VTL5 161 PSTLCLNLAGAPTLSVPLDNIEGYLYSEWRKGILDEWKTQEKVTYLAAKIQSGIEKTTRILQHANISESTQQNAFLETMA 240 Salmonella enterica
Q8VTL7 161 PTRLCLNLADEPFLSISLHSILRLVNSQLYKTN-SEWKAQEKINYLATKIRSGIENVMHTLHQTNISESTRQRAFLETMS 239 Salmonella enterica
Q8VLN2 161 PSTLCLKLAGTPFLSVPLNNIVKYLYSELDNRNLDKWKTQEKANYLAEKIRSGIEKAMRILYHADISESMQQRAFLETMS 240 Salmonella enterica
Q8VTL2 161 PSTLCLKLAGAPMLSVPLDNIDGYLYSEWRKGNLDEWKAQEKATYLEAKIQSGIKKTIQTLRHANISESTQQSALLKTMT 240 Salmonella enterica
3CXB_A 241 MCGLKQLEIPPPHTHIPIEKMVKEVLLADKTFQAFLVTDPSTSQSMLAEIVEAISDQVFHAIFRIDPQAIQKMAEEQLTT 320
Q8VTL5 241 MCGLKQLEIPPPYTHIPIEKMVKEVLLADKAFQAFLVTDPSTSQSMLAEIVEAISDKVFHAIFRIDPQAIQKMAEEQLTT 320 Salmonella enterica
Q8VTL7 240 MCGLKPIETSPPPTHVPIVKIVEMVLLENQVFKTFLENNANTRQSIQAELIEAISDNLFRDLFRTDPQAIQKMAEEQLTT 319 Salmonella enterica
Q8VLN2 241 MCGLKSTETSPPPTHIPIVKIVQEVLLADKKFKRFLATDTNASQSMLAEIIEIVSDGVFRALFRTDPQAIQKMAERAVNK 320 Salmonella enterica
Q8VTL2 241 MCGLKPVETPPPHTHIPIEKMVEEVLLADKKFQACLVSDASVSQNMLADIIETIADKVFHALFRIDPQVIQKMAEEQLTT 320 Salmonella enterica
3CXB_A 321 LHVRSEQQSGC-LCCFL 336
Q8VTL5 321 LHVRSEQQSGC-LCCFL 336 Salmonella enterica
Q8VTL7 320 LHIRWLRQGGSgLCCFL 336 Salmonella enterica
Q8VLN2 321 LYMFAQTNKWQ-IRGFL 336 Salmonella enterica
Q8VTL2 321 LHVRSDQQRGDgLCCFL 337 Salmonella enterica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap