Conserved Protein Domain Family
DUF1221

?
pfam06760: DUF1221 
Protein of unknown function (DUF1221)
This is a family of plant proteins, most of which are hypothetical and of unknown function. All members contain the pfam00069 domain, suggesting that they may possess kinase activity.
Statistics
?
PSSM-Id: 399620
View PSSM: pfam06760
Aligned: 17 rows
Threshold Bit Score: 305.811
Threshold Setting Gi: 75323622
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_006339677  24 QDDIQ-INQKQCCLLVDMLKCAYKTIAETMKQNLRFEEKNIKWKILENPLRELLRVFKEAEQYIKQ--SLENK-DFWAKA 99   potato
ERN01757      21 KDDIR-INRHQCSLLYEIFKLGLQGIAEEIRDNLKFDERLKKWKALEQPLKELFRTVKEGESYIKH--CLEPK-DSLGKA 96   Amborella tric...
Q6I584        21 HDDLRcINPRQCALLAHAYALAFRAVAGELRARLRFHDRLTKWKPLDDPLRELHRVVRDGEAYIRHclLLDPA-HWWARA 99   Japanese rice
Q9AXB6        21 EDDLH-INPRQCRLLADACARALAAVTGQVRAQLRFDERGAKWRAIEAPLRELHRAFRDAEAYVRQ--CLDPRgSWWARA 97   Japanese rice
EMS45702      21 eADLR-INPRQCRLLAETCAHALDAITGNVRAHLRFDERGTKWRALESPLRELHRALRDAEGYVRQ--CLDPRgSWWARA 97   Triticum urartu
Q944S4        21 QDDIL-INQRQCCLLLDIFSLGFNTVAEEIRHNLKLEEKHTKWRALEQPLRELYRVFKEGEMYVRN--CMSNK-DWWGKV 96   thale cress
XP_002280598  21 REDIQ-INQRQCCLLLDVLDLAYHTVAEEMKQNLRLDEKHTKWKILEQPLRELHGVFKEGEHYVRQ--CLDTK-EWWAKA 96   wine grape
XP_003548520  21 RESIQ-INHRQCCLLLDVFTFAYECIADEIIQNLKFEEKNGKWKILEQPLREIHKIFREGEAYIRH--CMETK-DWWAKS 96   soybean
XP_002532661  21 HDNIQ-INKRQCCLLVDIFIFAYDTIAEEMKQNLRFEEKHTKWRILEQPLREILRTFKDGEGYIKQ--CLETK-DWWAKA 96   castor bean
XP_002889366 292 KDDIQ-INQRQCSLLLDLFTAAYESISESMRSNLRFKEKNTKWKILEQPLRELLWVVREGEAYVRM--SLEPKlGFWAKA 368  Arabidopsis ly...
XP_006339677 100 IVLYKNTDCVEFHIHNLLSCVPIVIEAIEIAGEISGSDHDEIQKKRFIYSMKYQKECKDPRIFQWKFGEQYMVSQKFCER 179  potato
ERN01757      97 ISLPQNNDCVEFHLHNFIWCVFVVFESIEIAGEIAGYDQEETQKKKLLFSKRYEREWLDKSLFQWNFGKKYLVSREICNR 176  Amborella tric...
Q6I584       100 AAATHGTECVEHHLHNLLWCVSVVVEAVENVGEVTGSDPDELARRRLALARDYDKDLLDPKLFRERLGETFLATRELAAR 179  Japanese rice
Q9AXB6        98 AAMAHGTECVEQHLHNVLWCVAVALEAIDAAGEIAGSDPDELARGRLVLARKYDRDMLDPKLFEHAFGKLYLVSQELVAR 177  Japanese rice
EMS45702      98 AAMVHGTECVEHHLHNILWCVSVAVDAIEAAGEIAGSEPDDHARTRLLLASKYDRDMLEPKLFQLVHGKRYLVSRELVVR 177  Triticum urartu
Q944S4        97 INFHQNKDCVEFHIHNLLCYFSAVIEAIETAGEISGLDPSEMERRRVVFSRKYDREWNDPKLFQWRFGKQYLVPRDICLR 176  thale cress
XP_002280598  97 IIFYQNTDSVEFHIHNLLCCFPVVIEAIEIAGENSGWDQDEIQKKRVLFSTKYQKEWQDPKLFQWRFGKQYLISKDFCSR 176  wine grape
XP_003548520  97 IVMSHNNDCVEFHIHNLLCCMPVVIEAIESAGETSGWDQEEMQRKRLINSDKYRKEYRDMRLFQWKFGKQYLITQDFCRR 176  soybean
XP_002532661  97 VTLYQNTDCVQLYIHNLLTCIPIVIEAIETTGEFSGWDQDEIQKKRLVYSNKYQKQWKDPQLFHWKFAKQHLITQDFCER 176  castor bean
XP_002889366 369 IVLHCNRDCTELHIHNLLSCLPIIVEAIETAGEVSGWDEEEMSKKRLVHSNKYMKQWNDSQMFTWKFGREYLVTEDFCNR 448  Arabidopsis ly...
XP_006339677 180 VCSVWNEDKWILQNKIREKKNlga---ctlTKHEKRLADLLLKNLNEMEMESDhKLSPSSLLVNS 241  potato
ERN01757     177 LNTVWKEDRKMFLEILEEKRR---------TKSESRILDLLHKNFEGSEVSKG-DLFPCSILTDP 231  Amborella trichopoda
Q6I584       180 MDMAWKEDRWLLSQLLDERKGptsspepplTRQEHRLADLLAAPRG--------KLHPASVLLMS 236  Japanese rice
Q9AXB6       178 MDMAWKEDRWVISQMFDEMKGpaas--kplSKNEHRLAELLAAAMG--------KLHPASVLLGS 232  Japanese rice
EMS45702     178 MDAAWKEDRWALSQLLDEMTGpaap--krlTKNEHRLAEVLAAPRG--------RLHPASILLGG 232  Triticum urartu
Q944S4       177 FEHSWREDRWNLVEALQEKRKsks---deiGKTEKRLADFLLKKLTGLEQFNG-KLFPSSILVGS 237  thale cress
XP_002280598 177 VDEVWREDRWILLNKIQGKRPsgs---vslTKYEQRLRDLLFKNLDVSQPLNG-KLLPSSILLGS 237  wine grape
XP_003548520 177 YDTVWKEDRWFLYNKIHEKKVeg------iSKYEKKLIDLLLRNLERSESLVG-KLLPSSILVGS 234  soybean
XP_002532661 177 FDVVWKEDRWILLNKIKEKTVlc------sRKYERQLRDLLVKNLEEQDTENA-KLLPSSILVGS 234  castor bean
XP_002889366 449 FESAWTEDRWILIKELQEKKQps------lSKHDWKMADFLLKHLGDGNESP--KLFPSSLLVNT 505  Arabidopsis lyrata subsp. lyrata
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap