6LBA,6KA4


Conserved Protein Domain Family
DUF1221

?
pfam06760: DUF1221 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF1221)
This is a family of plant proteins, most of which are hypothetical and of unknown function. All members contain the pfam00069 domain, suggesting that they may possess kinase activity.
Statistics
?
PSSM-Id: 429105
Aligned: 19 rows
Threshold Bit Score: 304.652
Threshold Setting Gi: 75323622
Created: 27-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6LBA_A        23 QDDIL-INQRQCCLLLELFSLAFNTVAEEIRQNLKLEEKHT-KWRALEQPLRELTRVFKEGELYVKH--CMDNS-DWWGK 97  
ERN01757      21 KDDIR-INRHQCSLLYEIFKLGLQGIAEEIRDNLKFDERLK-KWKALEQPLKELFRTVKEGESYIKH--CLEPK-DSLGK 95   Amborella tric...
Q6I584        21 HDDLRcINPRQCALLAHAYALAFRAVAGELRARLRFHDRLT-KWKPLDDPLRELHRVVRDGEAYIRHclLLDPA-HWWAR 98   Japanese rice
Q9AXB6        21 EDDLH-INPRQCRLLADACARALAAVTGQVRAQLRFDERGA-KWRAIEAPLRELHRAFRDAEAYVRQ--CLDPRgSWWAR 96   Japanese rice
EMS45702      21 eADLR-INPRQCRLLAETCAHALDAITGNVRAHLRFDERGT-KWRALESPLRELHRALRDAEGYVRQ--CLDPRgSWWAR 96   Triticum urartu
XP_003548520  21 RESIQ-INHRQCCLLLDVFTFAYECIADEIIQNLKFEEKNG-KWKILEQPLREIHKIFREGEAYIRH--CMETK-DWWAK 95   soybean
XP_002532661  21 HDNIQ-INKRQCCLLVDIFIFAYDTIAEEMKQNLRFEEKHT-KWRILEQPLREILRTFKDGEGYIKQ--CLETK-DWWAK 95   castor bean
XP_002889366 292 KDDIQ-INQRQCSLLLDLFTAAYESISESMRSNLRFKEKNT-KWKILEQPLRELLWVVREGEAYVRM--SLEPKlGFWAK 367  Arabidopsis ly...
1_pfamImport   1 KDNIH-INQRQCTLLLDLFIATYDSVSESMRLNLRFGEKNTsKWKILEQPLRELLCVVREGEAYVRF--SLEPKlGFWAK 77  
XP_006339677  24 QDDIQ-INQKQCCLLVDMLKCAYKTIAETMKQNLRFEEKNI-KWKILENPLRELLRVFKEAEQYIKQ--SLENK-DFWAK 98   potato
6LBA_A        98 VINLHQNKDCVEFHIHNLFCYFSAVVEAIEAAGEISGLDPSEMERRRVVFSRKYDREWNDPKMFQWRFGKQYLLSRDICS 177 
ERN01757      96 AISLPQNNDCVEFHLHNFIWCVFVVFESIEIAGEIAGYDQEETQKKKLLFSKRYEREWLDKSLFQWNFGKKYLVSREICN 175  Amborella tric...
Q6I584        99 AAAATHGTECVEHHLHNLLWCVSVVVEAVENVGEVTGSDPDELARRRLALARDYDKDLLDPKLFRERLGETFLATRELAA 178  Japanese rice
Q9AXB6        97 AAAMAHGTECVEQHLHNVLWCVAVALEAIDAAGEIAGSDPDELARGRLVLARKYDRDMLDPKLFEHAFGKLYLVSQELVA 176  Japanese rice
EMS45702      97 AAAMVHGTECVEHHLHNILWCVSVAVDAIEAAGEIAGSEPDDHARTRLLLASKYDRDMLEPKLFQLVHGKRYLVSRELVV 176  Triticum urartu
XP_003548520  96 SIVMSHNNDCVEFHIHNLLCCMPVVIEAIESAGETSGWDQEEMQRKRLINSDKYRKEYRDMRLFQWKFGKQYLITQDFCR 175  soybean
XP_002532661  96 AVTLYQNTDCVQLYIHNLLTCIPIVIEAIETTGEFSGWDQDEIQKKRLVYSNKYQKQWKDPQLFHWKFAKQHLITQDFCE 175  castor bean
XP_002889366 368 AIVLHCNRDCTELHIHNLLSCLPIIVEAIETAGEVSGWDEEEMSKKRLVHSNKYMKQWNDSQMFTWKFGREYLVTEDFCN 447  Arabidopsis ly...
1_pfamImport  78 AVFLQHNIDCMELHVHNLLSSVPIIIEAIEMASELSGWDEQEMNKKRLVHSNKYMKQWNDSQMFTWKFGREYLVTEDLCS 157 
XP_006339677  99 AIVLYKNTDCVEFHIHNLLSCVPIVIEAIEIAGEISGSDHDEIQKKRFIYSMKYQKECKDPRIFQWKFGEQYMVSQKFCE 178  potato
6LBA_A       178 RFEHSWREDRWNLVEALQEKRKsds---ddiGKTEKRLADLLLKKLTGLEQFNG-KLFPSSILLGS 239 
ERN01757     176 RLNTVWKEDRKMFLEILEEKRR---------TKSESRILDLLHKNFEGSEVSKG-DLFPCSILTDP 231  Amborella trichopoda
Q6I584       179 RMDMAWKEDRWLLSQLLDERKGptsspepplTRQEHRLADLLAAPRG--------KLHPASVLLMS 236  Japanese rice
Q9AXB6       177 RMDMAWKEDRWVISQMFDEMKGpaas--kplSKNEHRLAELLAAAMG--------KLHPASVLLGS 232  Japanese rice
EMS45702     177 RMDAAWKEDRWALSQLLDEMTGpaap--krlTKNEHRLAEVLAAPRG--------RLHPASILLGG 232  Triticum urartu
XP_003548520 176 RYDTVWKEDRWFLYNKIHEKKVeg------iSKYEKKLIDLLLRNLERSESLVG-KLLPSSILVGS 234  soybean
XP_002532661 176 RFDVVWKEDRWILLNKIKEKTVlc------sRKYERQLRDLLVKNLEEQDTENA-KLLPSSILVGS 234  castor bean
XP_002889366 448 RFESAWTEDRWILIKELQEKKQps------lSKHDWKMADFLLKHLGDGNESP--KLFPSSLLVNT 505  Arabidopsis lyrata subsp. ly...
1_pfamImport 158 RYESAWREDMWLLTQELQEKRRpg------sSKQDRKMAEFLLKNLGDGN-----ELFPSSILVSS 212 
XP_006339677 179 RVCSVWNEDKWILQNKIREKKNlga---ctlTKHEKRLADLLLKNLNEMEMESDhKLSPSSLLVNS 241  potato
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap