Conserved Protein Domain Family
Ins_allergen_rp

?
pfam06757: Ins_allergen_rp 
Insect allergen related repeat, nitrile-specifier detoxification
This family exemplifies a case of novel gene evolution. The case in point is the arms-race between plants and their infective insective herbivores in the area of the glucosinolate-myrosinase system. Brassicas have developed the glucosinolate-myrosinase system as chemical defense mechanism against the insects, and consequently the insects have adapted to produce a detoxifying molecule, nitrile-specifier protein (NSP). NSP is present in the small white butterfly Pieris rapae. NSP is structurally different from and has no amino acid homology to any known detoxifying enzymes, and it appears to have arisen by a process of domain and gene duplication of a sequence of unknown function that is widespread in insect species and referred to as insect-allergen-repeat protein. Thus this family is found either as a single domain or as a multiple repeat-domain.
Statistics
?
PSSM-Id: 399618
View PSSM: pfam06757
Aligned: 77 rows
Threshold Bit Score: 109.959
Threshold Setting Gi: 122000602
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002004323         39 ELLQDLREFIDLIPSITVDEVVAEHMLTDSGFRKAIKFLRSSDFKHLQQRAESLPEIIEVINFVH--------------- 103 Drosophi...
Q2LZU8                2 TLALELRSIFRQIPRKQIEKLVQAYILNDEEFQGVVRDINSLQAYRLSRQLAAQPEVRQLLQWLSqqlilsgsslkifed 81  Drosophi...
KMY96740             42 NFALELKAVIRQIPVDNIEKLVQTYLLNDIEFQGVIRAINSLPAYRFYRQLINQPEVRQLQQWVTqqlilsgggpkifey 121 Drosophi...
XP_001956742         40 nFALELKGVIRQIPIGDIEKLVQAYLLNDPEFQAVIRAVNSLPAYRFIRQLANQPEVRQLQQWLSqqlilsggslkifdy 119 Drosophi...
WGS:AANI:GJ15876-PA 117 GLTSLIRKARPLLPAERLRNILANARE-DGEVRELLQLLRSDQFKERVTRLHNTKEKGVLRDYVCqtlklnh-------- 187 Drosophi...
WGS:AAQB:GK15414-PA 179 giprlLRTALPVLPADKLQNILANAVQSDAQVKNLVQLLRSDAFRQQVQNLRATKEYKTLQDYVCqrlkldy-------- 250 Drosophi...
XP_001962706        145 GLTNLIRVARPLLPASRLANILANAAE-DPQVRNLIKLLRSDRFKEQVSRLRSSKQHQILLAFICqklqldp-------- 215 Drosophi...
Q29PK9              154 GLTNLIRVARPMLPAAELRNIFANAVE-DPQVRDLLKLLKSNPFKEQVALLRSTKQHQMLQDYICrrlkldp-------- 224 Drosophi...
EDW02864            126 GLTRLIRNARPLLDLPRLSNILANARE-DGKVSDLFRLLRSDQFKERVRQLRNTKEQGALRDYVCqslklnh-------- 196 Drosophi...
XP_002002312        126 GLTALIRNARPLLPADRLRNILANARE-DPEVRALVKLLRSEQFQERVVRLNQIKEKIDQKDFLCrtlklny-------- 196 Drosophi...
XP_002004323        104 -------LNDTAirsRILinksveqqlrayayksygypsitesafneeenegdadenSLVVILvplniqqepkrstnLNS 176 Drosophi...
Q2LZU8               82 leleikvINKYPqasQL------------------------------------------------------------VNG 101 Drosophi...
KMY96740            122 leleikiFNKYPywsQI------------------------------------------------------------VSG 141 Drosophi...
XP_001956742        120 leleikvFNKYPfwsQL------------------------------------------------------------VNG 139 Drosophi...
WGS:AANI:GJ15876-PA 188 -ayylehVRLLF---NAQ---------------------------------------SSEPPSspl--------pnrRKG 216 Drosophi...
WGS:AAQB:GK15414-PA 251 -snyliyVRVFL---NIY---------------------------------------IDSKPTsdl--------pnrRPG 279 Drosophi...
XP_001962706        216 -tvyiqfVRVFL---NVH---------------------------------------TSEPPTspl--------pnrRQG 244 Drosophi...
Q29PK9              225 -ayyfdyVRIFL---NIH---------------------------------------TTEAPTspl--------pnrRKG 253 Drosophi...
EDW02864            197 -tyyieyVRLLI---NVQ---------------------------------------NTEPVTspl--------pnrRRG 225 Drosophi...
XP_002002312        197 -gyymeyVRMLF---NAQ---------------------------------------LSETPSspl--------pnrRKG 225 Drosophi...
XP_002004323        177 FVSFAQELLTHLPRDRFVALINEKRKS-GTVFPKFYEAIRSDAFKSLLDKTMKSQNVQSLIKTLASHDIDAESLK 250 Drosophila mo...
Q2LZU8              102 IRGFELEFFQIYPLELIRSLLEPSATQsSPALAELWRRLVA--LLPAYERVTGSPPGKLFIQKLQTRGVAVQDVD 174 Drosophila ps...
KMY96740            142 IQGFQAEFVQIYPVQLIRSLLEPSATQtSPLLSELWRRLVA--LRPVYERVLATPPGKVITAELQRLGVDVGgvd 214 Drosophila si...
XP_001956742        140 IQGFETEFAQVYPVELIRSLLEPSATQtSPLLSELWRRLVA--LRPVYERVLASAQGKAITNELQRLGVNINGvd 212 Drosophila an...
WGS:AANI:GJ15876-PA 217 VRGLLQDLRDAVPRAQLRELYRRQFAS-DKDLSEAVRRIRGTEFRRLLSNVRALPEYRAVRDDLQKAGVPLQQVL 290 Drosophila vi...
WGS:AAQB:GK15414-PA 280 VSGLLQDLRNALPRTQLRDLYVRLYAV-DRELSESVRLIRGREFRNVLRDIRITKEYISIREELRKADVPLQRVA 353 Drosophila wi...
XP_001962706        245 IRGLFQDLRDALPRAALRDMYLRLYAS-DSQLANSVRLIRGVEFRRLLRNLRGLKEYQLIVEELEKSGVSVRQVh 318 Drosophila an...
Q29PK9              254 IRGLLQDVRDVLPRTALRDLYLRMYAS-DAELSNAVRLVRSLEFRRLLQDVRSLKEYRGLTGDLEKAGVPLRQIQ 327 Drosophila ps...
EDW02864            226 VRGLLQDLRDALPRAQLRDLYRRQLVE-DRELATAVRRIRSLKFRLLLANVRALPEYRVVRNDLELAGVPLQLLL 299 Drosophila gr...
XP_002002312        226 IRGLLQDLRDALPRAALRDLYRRQLAS-DKELVTAVRHIRSREFRRLLINLRALPEYRALRDDLLKVGVPLQQLL 299 Drosophila mo...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap