Conserved Protein Domain Family
CbtA_toxin

?
pfam06755: CbtA_toxin 
CbtA_toxin of type IV toxin-antitoxin system
CbtA is a family of bacterial and archaeal toxins of type IV toxin-antitoxin system. Toxins from such systems in free-living bacteria inhibit cell growth by targeting essential functions of cellular metabolism. In this case the toxin inhibits cell-division leading to changes in morphology and finally lysis, by interacting with two essential cytoskeletal proteins, FtsZ and MreB. For FtsZ it inhibits its GTPase activity and GTP-dependent polymerization, and for MreB it inhibits its ATP-dependent polymerization. These actions of CbtA appear to occur simultaneously. he cognate antitoxin family is represented by pfam06154.
Statistics
?
PSSM-Id: 369065
View PSSM: pfam06755
Aligned: 3 rows
Threshold Bit Score: 222.894
Threshold Setting Gi: 123562967
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q46953   1 MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF 80  Escherichia coli K-12
Q32HN1   1 MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF 80  Shigella dysenteriae ...
P77692   1 MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF 80  Escherichia coli K-12
Q46953  81 SWQQQSPYISVVDILRARRSTGLLKTNV 108 Escherichia coli K-12
Q32HN1  81 SACTRSPLINSIDILRARRVTGLMTRDN 108 Shigella dysenteriae Sd197
P77692  81 SWQEQSPYLRAADILRARQATGLLRQSR 108 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap