4XB6


Conserved Protein Domain Family
PhnG

?
pfam06754: PhnG 
Click on image for an interactive view with Cn3D
Phosphonate metabolism protein PhnG
This family consists of several bacterial phosphonate metabolism protein PhnG sequences. In Escherichia coli, the phn operon encodes proteins responsible for the uptake and breakdown of phosphonates. The exact function of PhnG is unknown, however it is thought likely that along with six other proteins PhnG makes up the the C-P (carbon-phosphorus) lyase.
Statistics
?
PSSM-Id: 399617
Aligned: 82 rows
Threshold Bit Score: 89.1179
Threshold Setting Gi: 124262244
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4XB6_E            7 TRQHWMSVLAHSQPAELAARLNALnitaDYEVIRAAETGLVQIQARMGGTGERFFAGDATLTRAAVRLtDGT-----LGY 81  Escherichia ...
ABM05369          9 PRSAWIRALKLVPVDEIKALIDAVineyQVSYKSIPQTGLGVLQTKDTAMHEPYFLGEFPIAISWVVL-TDKqgktfEGA 87  Psychromonas...
Q31DV2            9 PRSLWMRALKMVCVEEIKAVIDAVineyQVAYKAVPQSGLGVLQTQDTALHEPYFLGEFPIATSWVVL-TDKqgncfEGS 87  Hydrogenovib...
ESQ15341          5 PREQWVRALSVIPEEALASVVQNFpdawEVTPNALPQEGLGLLKFRDSALGDAFYLGEFPLATCWLSI-TTPdavsaEGA 83  uncultured T...
Q3SGK1            4 ERKDWIRALTAHPAPDLHALAERLaagcELRLTRLPQAGLGLLQLADGAFHEAYYLGEFPLSTCSLEL-TLAdgrraEGG 82  Thiobacillus...
CDC28239          2 eKRRLSKILAKADAAQVRQMAEKIrkqhEVTVIKAPEKSLTMIKMRDPVKETLFFLGEVIVCEAIVCL-DGT-----KGM 75  Firmicutes b...
WP_009270830      2 KRKERTRILVHCSNEFLTQWAQYFeqqtQFHVIEEPKNALTMLRMRESAQHSLFYLGEVLVSETRVKC-RDT-----IGI 75  Firmicutes
Q8CUY9            2 KRKRRTEILIQGDANLVDNLAEEIkqnyQWQEFSPPSYSLTMMKMRETAQQSLFHIGEVLVTEAKVEV-SGQ-----IGV 75  Oceanobacill...
jgi:Desaci_1727   2 iRKRRTKTLIEGSAKVSAKLAQEIvkayDVKTIEESNNSLVMVKVRESAQKSLFYLGEVLITECKVMV-AES-----LGI 75  Desulfosporo...
WP_015616614      2 RRRRRTEILIKGSSEIAKNMFKEIeknyEIKTIEEPDSALVMIKMRESSKNSLFYLGEVLVTEAKVQI-NEA-----FGI 75  Clostridium ...
4XB6_E           82 SWVQGRDKQHAERCALIDALMQQSRHFQNLSETLIAPLDADRMARIAARQAEVNASRVDFFTM 144 Escherichia coli str. K-12 su...
ABM05369         88 AQLMDDDQNLASLLAVCDAILANDLMACSKLSDLLERGEFKFEQEALTRKAMLGSTVVDFsll 150 Psychromonas ingrahamii 37
Q31DV2           88 AQLMDDDENIASLFAVCDTVLANNLLYCRKLADLVELGEFKFSEKVKARKAMLGSTAVDFSll 150 Hydrogenovibrio crunogenus XCL-2
ESQ15341         84 AMVMDDRAERAEQMALCDAVLSAQLPGWEAVAKLIEQGGEQLALKARERKSMLAKTRVDFSll 146 uncultured Thiohalocapsa sp. ...
Q3SGK1           83 AQVMADDAALARTLAILDAVLAARLPGWEDVSAQVQAGARLRAEADRRRRAMLAATRVDFALL 145 Thiobacillus denitrificans AT...
CDC28239         76 AVIMGDDFEKVLDMAIIDASCNKGVFTD---EGLLVELEKAQQTRVEKENAMFMQTMVNFTTM 135 Firmicutes bacterium CAG:466
WP_009270830     76 GLIQGNELEKSYALAVIDAACNAALDGVDQLEKALTQEKQKQDAAHARHVAGILKTRVNFETM 138 Firmicutes
Q8CUY9           76 GIVIGMKDDLSINLAMIDAAYKAELPETINWNQLLIKEEQRIHTKKVKKQQEILKTKVHFDTM 138 Oceanobacillus iheyensis
jgi:Desaci_1727  76 GIVKGYEPTLAYNLAIIDAAYNAGLPETKEWTDVLLLEEVLIKEKYEALKKKVLKTKVNFDTM 138 Desulfosporosinus acidiphilus...
WP_015616614     76 GIVRGNKPEFAYWLAVIDAAYNLELKETGSWEKILVEEEKRIKTEEALNDSKILKTKVNFESM 138 Clostridium pasteurianum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap