2QEZ,3ABO


Conserved Protein Domain Family
EutB

?
pfam06751: EutB 
Ethanolamine ammonia lyase large subunit (EutB)
This family consists of several bacterial ethanolamine ammonia lyase large subunit (EutB) proteins (EC:4.3.1.7). Ethanolamine ammonia-lyase is a bacterial enzyme that catalyzes the adenosylcobalamin-dependent conversion of certain vicinal amino alcohols to oxo compounds and ammonia. The enzyme is a heterodimer composed of subunits of Mr approximately 55,000 (EutB) and 35,000 (EutC).
Statistics
?
PSSM-Id: 399615
Aligned: 106 rows
Threshold Bit Score: 576.364
Threshold Setting Gi: 504210973
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2QEZ_A        13 YQFKSITDVLAKANEEKSGDRLAGVAAESAEERVAAKVVLSKXTLGDLRNNPVVPYETDEVTRIIQDQVNDRIHDSIKNW 92 
P19264        12 YQFKDVKEVLAKANELRSGDVLAGVAAASSQERVAAKQVLSEMTVADIRNNPVIAYEEDCVTRLIQDDVNETAYNRIKNW 91  Salmonella ente...
Q3A7B7        49 fdqttYQQVIGAANAFKEGDEGLGVAADTEADRVNARKLLANTKIKDIFENPLF---VDGQEELIRKTTDKAKYNKIKNM 125 Pelobacter carb...
Q3A793        49 fdqplyQQVLGAANSFKEGDEAIGVAADDDASRENARKLLANTKIKDLMAKPLF---VDAQYDLITNTTDMAQYNKVKDW 125 Pelobacter carb...
Q1D7L7        18 fddtlyKQVLGAANTFKEGDALVGVAAADENSRANARRLLGHTRLEDVRRHPLH---QDALHALSLEAEDSQAATLTADW 94  Myxococcus xant...
WP_014398075  25 fdarlyQQVLGAANAFKEGDEAIGVAAADEDSRRNARTLLSRTQLDELHAHPPF---EDRLYVFNLEAWDAARWKRVADW 101 Corallococcus c...
WP_011735133  47 fdqvlyQQVIGASNAFKEGDKTIGVAADTNTSRENARKLLANTKIKDITNHPLH---NDDLYKFIAKSVDPAQYAKIKDW 123 Pelobacter prop...
CDA12992      12 YEFKSIKEVLAKANEQKSGDTLAGIGAENAKERVAAKYVLADLTVEDITNSPAVEYEKDSVTRIILDDLDAAQYEKIKKL 91  Anaerotruncus s...
WP_014078288  12 YEFKDVKDVLAKASEKKSGDELAGVGAESALERIAAKEVLAQLTVADLTEHPVVPYEEDAVTRIIQDDIDETVYGTIKDR 91  Roseburia hominis
3ABO_A        12 YQFKDVKEVLAKANELRSGDVLAGVAAASSQERVAAKQVLSEMTVADIRNNPVIAYEDDCVTRLIQDDVNETAYNQIKNW 91 
2QEZ_A        93 TVEELREWILDHKTTDADIKRVARGLTSEIIAAVTKLXSNLDLIYGAKKIRVIAHANTTIGL----PGTFSARLQPNHPT 168
P19264        92 SISELREYVLSDETSVDDIAFTRKGLTSEVVAAVAKICSNADLIYGGKKMPVIKKANTTIGI----PGTFSCRLQPNDTR 167 Salmonella ente...
Q3A7B7       126 TMGELKNFLL--TKSEADIKAIMGGLHSDVIGSVVKLMSNDELIRVGSKI-----FNPLPGSkigaKGYIGARIQPNSPT 198 Pelobacter carb...
Q3A793       126 TLGELKDFLL--TKSESQIKGIMYGLHSDIIGNVVKMMSNDELTRIGQTV-----FNPLPGSnigaKGYLSARIQPNSPT 198 Pelobacter carb...
Q1D7L7        95 TLGRLRKFLL--ESDEAAIHAIGPGLGSDTIGCVVKLMSDAELIALGSKV-----FNPLPGSkvgaRGYMGARIQPNSPT 167 Myxococcus xant...
WP_014398075 102 TLGQLKAFLL--TAPVPQVHDVLDGLPSDVIACVVKLMSDAELKTVGGRI-----FHPLPGSrvgaKGYLSARLQPNSPT 174 Corallococcus c...
WP_011735133 124 TMGRMKAFLL--DKSEAEIKSVMYGMNSEVVGCLPKLMSNKELIAVNRKI-----FNPLPGTkigaKGYLSARIQPNSPT 196 Pelobacter prop...
CDA12992      92 TIGELREKVLDNMIAGDEILALARGMSSEVIAALAKLMGNLDLMYVSRKLHITAHCNTTIGL----PGTFAVRLQPNHPT 167 Anaerotruncus s...
WP_014078288  92 TIQEMREWILCDATDSGALMRASRGMTSEVIAGISKIMSNMDLILAGSKIRVTATCNTTIGT----ENVLASRLQPNHPV 167 Roseburia hominis
3ABO_A        92 SISELREYVLSDETSVDDIAFTRKGLTSEVVAAVAKICSNADLIYGAKKMPVIKKANTTIGI----PGTFSARLQPNDTR 167
2QEZ_A       169 DDPDGILASLXEGLTYGIGDAVIGLNPVDDSTDSVVRLLNKFEEFRSKWDVP--TQTCVLAHVKTQXEAXRRGA-PTGLV 245
P19264       168 DDVQSIAAQIYEGLSFGAGDAVIGVNPVTDDVENLTRVLDTVYGVIDKFNIP--TQGCVLAHVTTQIEAIRRGA-PGGLI 244 Salmonella ente...
Q3A7B7       199 DNKEDIQMQVFDGFSYGVGDIIIGTNPVDSQLEATLRVENALKEIVTAFGLEktIPWCVLSHIDGQAAAEKEEPgSTAIW 278 Pelobacter carb...
Q3A793       199 DNADDIVWQVFDAYAYAVGDLVVGTNPVDSEAANIENIELALRDVMQTFDVDkyNPWCVLSHIDVQAEVEKNNPgSTAIW 278 Pelobacter carb...
Q1D7L7       168 DNVDDIRWQVFDGFSYAVGDVVLGCNPVSSTPESVAAIESALLEVLVTFGLTdvLPHCVLSHIDVQAEVERRQPgTTGVW 247 Myxococcus xant...
WP_014398075 175 DHPEDIRWQVFNGWSFAVGDVVLGTNPVSSDVASVAAVESALHDVLVTFGLEevMPHCVLSHIDVQAQVEAMRPgTTGIW 254 Corallococcus c...
WP_011735133 197 DDPEEIMMQVLSAFSYGVGDLVLGTNPVDGTKEQTARVEASLKDVVDTFKLNgtIPWCVLAHIDVQREIFNEKPeLIDCM 276 Pelobacter prop...
CDA12992     168 DDVKGVTASLLEGLSYGAGDAVLGLNPAVDTVKSTADILNLFNDVKTRLKIP--TQICVLSHITTQIQALRQGV-PMDLC 244 Anaerotruncus s...
WP_014078288 168 DDVEGVAASTLEGLSYGIGDAVIGLNPAIDTVDSTLAIWKVLGDIRDKYEIP--TQTCVLSHVTTQMEALRTGQgSADLC 245 Roseburia hominis
3ABO_A       168 DDVQSIAAQIYEGLSFGVGDAVIGVNPVTDDVENLSRVLDTIYGVIDKFNIP--TQGCVLAHVTTQIEAIRRGA-PGGLI 244
2QEZ_A       246 FQSIAGSEKGNTAFGFDGATIEEARQLALQSGAATGPNVXYFETGQGSELSSDAHFGVDQVTXEARCYGFAKKFDPFL-- 323
P19264       245 FQSICGSEKGLKEFGVELAMLDEARAVGAEFNRIAGENCLYFETGQGSALSAGANFGADQVTMEARNYGLARHYDPFL-- 322 Salmonella ente...
Q3A7B7       279 FQSLAGTESANKTFDLTIQKMIDYAKMRTG-PYS-----LYFETGQGADYTNGHGHGFDMVVHESRKYGFSRALKQVTak 352 Pelobacter carb...
Q3A793       279 FQSLAGVVDANKTFDLTLQKMMDYARMRTG-KYG-----LYHETGQGADFTNGHGKGFDMVVHESRKYGFARALKQQVaa 352 Pelobacter carb...
Q1D7L7       248 FQSIAGSDSANATFDISVEKMLAYADGRTG-PYG-----LYFETGQGADFTNGHGHGYDMVLHESRKYGFARALSQRVar 321 Myxococcus xant...
WP_014398075 255 FQSLGGNEAANRTFDVTLEKMVAHAAARTG-KWG-----LYFETGQGADATNGHHFGTDMLIHESRKYGFARALKRRVal 328 Corallococcus c...
WP_011735133 277 FQSLAGTDTANKTFDISVEKMVDHAKSRAGQRYG-----LYFETGQGSDFTNGGAEGVDMVVLESRKYGMARGLQQVLaq 351 Pelobacter prop...
CDA12992     245 FQSIAGSEAALSSFGTDVDMLENANELMAKYSTAEGPNYMYFETGQGSELSSSAHNGADQLVMESRCYGLARHYSPFL-- 322 Anaerotruncus s...
WP_014078288 246 FQSIAGSEAALSAFGINTGMLSEAEMLFREEGPAKGPNVMYFETGQGSELSSSAAFGSDQQTMECRCYGLARHYHPFL-- 323 Roseburia hominis
3ABO_A       245 FQSICGSEKGLKEFGVELAMLDEARAVGAEFNRIAGENCLYFETGQGSALSAGANFGADQVTMEARNYGLARHYDPFI-- 322
2QEZ_A       324 --------------VNTVVGFIGPEYLYDSKQVIRAGLEDHFXGKLTGISXGCDVCYTNHXKADQNDVENLSVLLTAAGC 389
P19264       323 --------------VNTVVGFIGPEYLYNDRQIIRAGLEDHFMGKLSGISMGCDCCYTNHADADQNLNENLMILLATAGC 388 Salmonella ente...
Q3A7B7       353 akgvt--edqvwlhVNDVAGFIGPEVFKTREQLVRCCLEDIVMGKLHGLVLGLDICSTLHMPVTLDDLAWCQDQIAPANP 430 Pelobacter carb...
Q3A793       353 aqtdg---qgawchVNDVAGFIGPEIFKTREQLVRCCLEDIAMGKLHGLIIGLDICSTLHMPVTLDDLDWCQDQIAPANP 429 Pelobacter carb...
Q1D7L7       322 arqg----aapwvhLNDVAGFIGPEVFRTREQLVRCCLEDIAMGKLHGLTIGLDICSTLHMDVSLDDLDWCIERIMPANP 397 Myxococcus xant...
WP_014398075 329 aqsgagrdaapwvhVNDVAGFIGPEVFRTREQLVRCCLEDIVMGKLHGLTLGLDVCSTLHMDVTLDDLGWCQEQLAEAGP 408 Corallococcus c...
WP_011735133 352 vqpq-----gaylhVNDVAGFIGPEVFRTKEQLVRCCLEDILMGKLQGITIGLDICSTLHMSVSLDDLEWCQDQIMPANP 426 Pelobacter prop...
CDA12992     323 --------------VNTVVGFIGPEYIYDTKELIRAALEDNFCGHMHGLPMGCDICYTNHMKADQNDSDSLLVMLVSAGC 388 Anaerotruncus s...
WP_014078288 324 --------------VNTVVGFMGPEYIYDTKQLTRAALEDVFCGHLHGLPMGCDVCYTNHMPTDQNDSETILTLLGTAGV 389 Roseburia hominis
3ABO_A       323 --------------VNTVVGFIGPEYLYNDRQIIRAGLEDHFMGKLSGISMGCDCCYTNHADADQNLNENLMILLATAGC 388
2QEZ_A       390 NFIXGIPHGDDVXLNYQTTGYHETATLRELFGLKPIKEFDQWXEKXGF-SENGKLTSR 446
P19264       389 NYIMGMPLGDDIMLNYQTTAFHDTATVRQLLNLRPSPEFERWLETMGIm-ANGRLTKR 445 Salmonella enterica subsp. enterica s...
Q3A7B7       431 AYLMALPTRNDPMLSYLTTGFQDHVRIREKFGFKVNDAMWDFYKKIEViDANGKPTKH 488 Pelobacter carbinolicus DSM 2380
Q3A793       430 GYLMALPTKNDPMLSYLTTAYQDHVRMREKFGYKINDDMWNFFKKIEIiDANGKPTEH 487 Pelobacter carbinolicus DSM 2380
Q1D7L7       398 AYLMSLPTKNDPMLGYLTTGFQDHVRIREQFGYKVDDRMWAFFQRLGViDAEGKPTRH 455 Myxococcus xanthus DK 1622
WP_014398075 409 AYLMALPTRNDPMLSYLTTSFQDHVRLRERYGLKVDDRMWAFFQSLGViNADGRPTKH 466 Corallococcus coralloides
WP_011735133 427 AYLMALPTRNDPMLSYLTTSYQDHVRIRSKFGYKVNDTMWDFFKRIQViDKNGKPTKH 484 Pelobacter propionicus
CDA12992     389 HYVMAVPQSDDVMLMYQSTSYHDIAAIREMLNLSPIEPFRQWLEKYGIw-ENGRLGKN 445 Anaerotruncus sp. CAG:528
WP_014078288 390 HYVMGLPQADDIMLMYQSTSYHDVASIRQLLKKEPIPEFKAWLEKRGIw-ENGHLGPN 446 Roseburia hominis
3ABO_A       389 NYIMGMPLGDDIMLNYQTTAFHDTATVRQLLNLRPSPEFERWLESMGIm-ANGRLTKR 445
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap