5E27,4OW1,4CGE


Conserved Protein Domain Family
Transglycosylas

?
pfam06737: Transglycosylas 
Click on image for an interactive view with Cn3D
Transglycosylase-like domain
This family of proteins are very likely to act as transglycosylase enzymes related to pfam00062 and pfam01464. These other families are weakly matched by this family, and include the known active site residues.
Statistics
?
PSSM-Id: 399604
View PSSM: pfam06737
Aligned: 15 rows
Threshold Bit Score: 95.174
Threshold Setting Gi: 122538961
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5E27_A       167 DGSIWDAIAGCEAGGNWAINTGNGYYGGV-QFDQGTWEANGGLRYAPRADLATREEQIAVAEVTRLRQGWGAWPVC 241 Mycobacterium tuber...
Q9L157        47 LRTDWDAIAACESSGNWQANTGNGYYGGL-QFARSSWIAAGGLKYAPRADLATRGEQIAVAERLARLQGMSAWGCA 121 Streptomyces coelic...
Q8CK41        43 DAATWDKVAACESTDDWDINTGNGYYGGL-QFTQSTWEAFGGTRYAPRADLATREQQIAGAEKVLDTQGPGAWPVC 117 Streptomyces coelic...
WP_012750944  43 TVDTWDRLAECESNGTWDINTGNGFYGGV-QFTLSSWQAVGGEGY---PHQASKAEQIKRAEILQDLQGWGAWPLC 114 Micrococcus luteus
Q9F2Q2        43 TASEWDAVAQCESGGNWSINTGNGYYGGL-QFSASTWAAYGGTQYASTADQASKSQQIQIAEKVLAGQGKGAWPVC 117 Streptomyces coelic...
Q6M6N7       293 ANSVWDQLAQCESGGNWAINTGNGFSGGL-QFHPQTWLAYGGGAFSGDASGASREQQISIAEKVQAAQGWGAWPAC 367 Corynebacterium glu...
Q8FR70        40 PDSDWDRLANCESGGNWAINTGNGYHGGL-QFSPSTWRAYGGDEFAPFAYQATREQQIAVAERTLAGQGWGAWPAC 114 Corynebacterium eff...
Q9F2Q1        42 DSTNWDQVAECETGGAWSQNSGNGYYGGL-QLSQDAWEQYGGLDYAPSADQASRSQQIRIAEKIHASQGIAAWPTC 116 Streptomyces coelic...
Q8CJX5       380 DHLNWQGLAACESGGRADAVDPSGTYGGLyQFDSATWHGLGGEG---RPEDASAAEQTYRAQKLYVRSGADAWPHC 452 Streptomyces coelic...
4CGE_F         1 -SVNWDAIAQCESGGNWSINTGNGYYGGL-RFTAGTWRANGGSG---SAANASREEQIRVAENVLRSQGIRAWPVC 71  Mycobacterium tuber...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap