5VRE


Conserved Protein Domain Family
DUF1211

?
pfam06736: DUF1211 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF1211)
This family represents a conserved region within a number of hypothetical proteins of unknown function found in eukaryotes, bacteria and archaea. These may possibly be integral membrane proteins.
Statistics
?
PSSM-Id: 399603
Aligned: 206 rows
Threshold Bit Score: 47.5127
Threshold Setting Gi: 121724016
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5VRE_C        12 RIEAFSDGVFAIAITLLVLEIKVPQhki-------------vetVGLVSSLLSLWPSYL--------AFLTSFASILVMW 70  Chamaesiphon mi...
AEV86457      23 RLAALSDGIFAVTMTLLVLDLHVPVaaevsrqrplwsagavapeRALWGALVHVGPSAL--------AFALSFLTLGMFW 94  Actinoplanes sp...
WP_025299114  14 RIIAISDGVFGVAMTLLVLEIRVPLaegf------------tsdKELAHSFLALMPKFL--------VYFLSFMTAGIFW 73  Niabella soli
WP_015898337  15 RLAALSDGIFAVAMTLLVLDLHLPAseai------------hseHGLQAALWTLAPQVL--------VYLMSFMTLGIFW 74  Acidobacterium ...
BAF87458       8 RVEALSDGIFAFAMTLLVLDIRLPAdlpi------------tspQELSAQIFGLWPQAL--------TYLISFFVLGALW 67  Azorhizobium ca...
CAL77330       6 RLDTLSDSIFGVAMTLLALDVRLPDdfhp------------rdgQELIDGIVNLWPKFF--------PYVLSFAVLGLRW 65  Bradyrhizobium ...
WP_009737241   6 RLDALTDGVFSVAMTLLVIDLRLPEafrp------------qdaGDLLQRIDELGSQLL--------VYVVSFYVLALRW 65  Bradyrhizobiace...
Q6N656         9 RLEQLSNTIFGVAMTLLAYQA---P-------------------REKFASADPQWREIWhlygaflsTLLLSFIVAGMFW 66  Rhodopseudomona...
WP_023991184  19 RIETLVDGIFAIAMTLLVLGITVPSian-------------pteAALYQAIYDLIPNLY--------SYALSFMLLAIFW 77  Methanobacteriu...
O27534         8 RLEGLVDAIFAIAMTILVLGIDVPTgtm--------------svPAMDAYIMGLASDLY--------SYCLSFLLLGVFW 65  Methanothermoba...
5VRE_C        71 VNHHRIFSLVARTDHAFFYWNGLLLMLVTFVP 102 Chamaesiphon minutus PCC 6605
AEV86457      95 LGQQTQLNYCARGDRQLSWLHLTFLLGVSFMP 126 Actinoplanes sp. SE50/110
WP_025299114  74 TGHAAQFRLIEKSDRNLSWINLLFLLFVTLLP 105 Niabella soli
WP_015898337  75 NGQQTQFHFFERSDRDLSWLHLGFLFTITVMP 106 Acidobacterium capsulatum
BAF87458      68 RAGIELRRAEETIAGGLLRVWLVYLFFITALP 99  Azorhizobium caulinodans ORS 571
CAL77330      66 LANVRVRSRADEVPRAYVRWWLLYLMLITCIP 97  Bradyrhizobium sp. ORS 278
WP_009737241  66 VGMVKIAPRGEDVSDAYTKWALLHLLLITLVP 97  Bradyrhizobiaceae bacterium SG-6C
Q6N656        67 YSHQRRLTYATDAGRIEVLVNLFFLLSIIVLP 98  Rhodopseudomonas palustris
WP_023991184  78 RLNHLQFNRIQRADATLLWIIVVWLLFVALVP 109 Methanobacterium sp. MB1
O27534        66 WVNHMHFEKLEKVDTGFIWINIVWLMVVVLVP 97  Methanothermobacter thermautotrophicus str. Delta H
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap