Conserved Protein Domain Family
CENP-R

?
pfam06729: CENP-R 
Kinetochore component, CENP-R
This family consists of mammalian kinetochore sub-complex proteins CENP-R, also referred to as nuclear receptor co-activator NRIF3 proteins. NRIF3 exhibits a distinct receptor specificity in interacting with and potentiating the activity of only TRs and RXRs but not other examined nuclear receptors. NRIF3 as a co-regulator that possesses both transactivation and transrepression domains and/or functions. Collectively, the NRIF3 family of co-regulators may play dual roles in mediating both positive and negative regulatory effects on gene expression. CENP-R is one of the 15 components that make up the constitutive centromere associated complex (CCAN) part of the kinetochore. A sub-complex of CCAN, consisting of CENP-P/O/R/Q/U self-assembles on kinetochores with varying stoichiometry and undergoes a pre-mitotic maturation step. Kinetochore assembly is a cell cycle regulated multi-step process. The initial step occurs during interphase and involves loading of the 15-subunit constitutive centromere associated complex (CCAN). Kinetochores are multi-protein megadalton assemblies that are required for attachment of microtubules to centromeres and, in turn, the segregation of chromosomes in mitosis.
Statistics
?
PSSM-Id: 399600
View PSSM: pfam06729
Aligned: 11 rows
Threshold Bit Score: 185.373
Threshold Setting Gi: 345313523
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_027318666  32 KKKNLNLYSPTTGTRQISPFSSPTSRNARDLRNGLSNDLpgdgnKQNELEIRLSRRGQCQAEKD-AFAELQSKVKSSLVR 110 mallard
XP_014312227  25 RKRGFTNYSPSTGTCRLSPYASPTNSKEQEHKNGPTNGK-----KKKLNHLSLTQRNKSTTKDN-ELMVLLSKVEKSSEE 98  little brown bat
Q2KIL6        25 RKKSAADYSPTTGTCQMSPVASPTSSKEQENRNGPSNGK-----RENLNHLSINKRMESTMQDN-EFMVLLSKVEKSSEE 98  cattle
Q9CQ82        25 RKKSITAYSPTTGTYQLSPFSSPATPKEQEHRNGPSNET-----RKRSN-LSSPVRQESTVKDRdGFMVLLSKIEISSEK 98  house mouse
XP_012403017  25 G-QLIASYSPTTGTRQISPYSSPKSHNGRELRNGPSNEQ-----VEADQSHTVPRRGQPRAEDKdDIMILLYTIDKSLEK 98  Tasmanian devil
XP_003429403  26 rrKFTEMFSPTTGTRQISPFSSSPNCKIQKIKNDQPKDKm----ESTDLHPRVSSREQSPAEENdKLLMLHSKIEKSLES 101 platypus
Q1T763        25 KKKDLNSYSPTTGTCQISPFSSPTSHNAEDLRNGLSHGD------ETNSESRLSRRGQPQTAED-AFAELQSNVKSSLVR 97  chicken
EHA99592      25 RKRSITSYSPTTGTHQMSPFSSPTSSKKQKHRNRPSNGK-----RKKLDHLGLAERKECPPKDD-EFMVMFSKAEKSLEE 98  naked mole-rat
XP_003775722  25 RKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLSNEK-----RKKLNHPSLTESKESTTKDNdEFMMLLSKVEKLSEE 99  Sumatran orangutan
XP_030134450  26 KMSNLNFYSPTTGTRQLSPCSSPTWDRAQDPSSAPAEGDg---nEQSNSKSGFSRRGQPQTEDD-VFLQLQSQVRNSLPR 101 zebra finch
XP_014595575  25 R-KNVTAYSPTTGTCQMSPFASPTSSKEGEHESGPSNGK-----RKKLNCLSLTQRKEATTKDSdEFMVLLSKVEKSSEE 98  horse
XP_027318666 111 FLKTRASLTNLQALEGSRELENIIGVSDLSCVLSAEVQKTQVLMGQAEELQLLERNHGKLPAQ 173 mallard
XP_014312227  99 IMEITQSLSITQALNDSRKLQNLIGISYGPCFLKREMKKTKELMTKVIKQKLFEKKSSEPSNK 161 little brown bat
Q2KIL6        99 FMEIMQNLSSIQALKGSKELENLIGIPHASCVFKREMQKTKKLMTKVIKQKLFKKKNSGLPNK 161 cattle
Q9CQ82        99 TMEIMKNLSSIQALEGNRQLEDLIGVSLVPCSLKSEARKTKELMTKVIKQKLFEKKKSRITPK 161 house mouse
XP_012403017  99 FMETWQSLKHLQTLLGQPELENLIGVSCTSLDLRSELKKTRELMMKARKWDQLRKKTlprdfg 161 Tasmanian devil
XP_003429403 102 FMEQRQRLESLQALEGSKELAMILGDFSHSCDLKAELQKTKELMVEIKRRKLLERNDPRHPTQ 164 platypus
Q1T763        98 ILKARENLTSLQALEGSRELENIIGVSDSSHILSAEVQKTQALMSQAEELQLLKRNHGQLPAR 160 chicken
EHA99592      99 IVEIMWNLRSVQALEGNKKLENLLGTSCTSRFLKREVKKTKELLTKVTKQELSEKKTSGLLHK 161 naked mole-rat
XP_003775722 100 IMEIMQNLSSIQALEGSRELENLIGISCASRFLKREMQKTKELMTKVNKQKLFEK-STGLPHK 161 Sumatran orangutan
XP_030134450 102 ILKLRANLTSLKALEGSRELENILGVSHSSCDLSAELQKTQALVSQAEKLQLLKENYGKVPAR 164 zebra finch
XP_014595575  99 IMEIMQNLSSIQALEGSRELENLLGISRASCFL-REMQKTKELMTKATKQKLFEKKSSGLPNK 160 horse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap