Conserved Protein Domain Family
DUF1206

?
pfam06724: DUF1206 
Domain of Unknown Function (DUF1206)
This region consists of two a pair of transmembrane helices and occurs three times in each of the family member proteins.
Statistics
?
PSSM-Id: 399597
Aligned: 386 rows
Threshold Bit Score: 28.5412
Threshold Setting Gi: 81543575
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Anae109_3010 243 LGFGTQGAIFALVGAFLVQAAFERQPLEATGTGGALAAL--ARKP-YGTTLLLSAAIGLLAYALYAGLEGALK 312 Anaeromyxobacter s...
WP_025310874     116 AGMLVTGVIHLGIGLLALGTLIGSSSGG--GTGGIVATV--MQLE-GGRWIIGAAGALTLCASAYYFDKGIKG 183 Roseibacterium elo...
WP_083812720      85 LKAAGQAVVFAAFAVTLASFAIGTGRDNSQSTSDFTIAL--MKAP-GGVALLIVIGAAVAVTGIVYGIRGVRK 154 Arthrobacter sp. FB24
tigr:AAur_3927   103 LSALGQALVFAALAATIMSFVVGQGQNSRESSSDFTVTL--MKAP-FGVFLLVAIGAGVAITGIVFAVRGFRQ 172 Paenarthrobacter a...
WP_015883135     108 IGAAGKAVAFVVFGILAIRTTGGGGSG---GGEAAAGGV--LASP-GGTAIVTVGGLAVVAIGVYQVVRGVRR 174 Beutenbergia cavernae
BAJ73340         104 aaeapQGIVFVVIGVISAAVALGARPRAEQTTEDVSQSV--LSLP-IGGFVLGTAGLVVAAVGVGFVWMGVRR 173 Microbacterium tes...
WP_014377340     122 akCLAKGAVYGVLGLTALLFAAGFEYEADERLRDLTEET--LLIP-GGALLIGTVAAGVVAVGIYTFVRGCTG 191 Blastococcus saxob...
WP_012949822     119 akCLAKAAVYGVLGITGLLFALGLEYEADERFRELTGET--LEVP-GGALLVYTVAAGVVAVGLYTLVRGLTG 188 Geodermatophilus o...
WP_014742213     118 akCTAKGAVYAVLGVTALFFAVGAEYDAADRFRELTDDA--LEIP-GGTAGVVAVGVGVAAVGAYTLVRGLTG 187 Modestobacter marinus
WP_012097817      63 VGFLGKTVLYGVVGALALQTALGLRGG---RTIDVKEALlvLDVGaAGRATTVLVGAAIAILGGWFVLDGLan 132 Anaeromyxobacter s...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap