Conserved Protein Domain Family
AraC_N

?
pfam06719: AraC_N 
AraC-type transcriptional regulator N-terminus
This family represents the N-terminus of bacterial ARAC-type transcriptional regulators. In E. coli, these regulate the L-arabinose operon through sensing the presence of arabinose, and when the sugar is present, transmitting this information from the arabinose-binding domains to the protein's DNA-binding domains. This family might represent the N-terminal arm of the protein, which binds to the C-terminal DNA binding domains to hold them in a state where the protein prefers to loop and remain non-activating. All family members contain the pfam00165 domain.
Statistics
?
PSSM-Id: 399595
Aligned: 298 rows
Threshold Bit Score: 62.8973
Threshold Setting Gi: 570733609
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
utah:Sant_P0086         28 GVILVRADQEKP-PAHLLAKPALCVVAQGTKWTSFGD-Q-RHRYGAGQALLVNVEMPSVGRVVQASADCPFLGVIIELDP 104 Sodal...
WP_052346121            32 eLNVFETHQTAHqVPLNMGHVVLTTMLRGKKVMHLPG-QpAFEYLPGESVIVGENETMVIDFPEADEQHPTQCLAVAIPT 110 Hymen...
WP_012779690            34 eLNLFETLQPSAlVPLTFPDFVVTSMLRGKKVMHLFD-QpGFDYLPGETVLVPANVTMKIDFPEAQRDNPTQCIALAIDH 112 Dyado...
CCB70301                35 eLNLFETYQTSElVPLKFNDLVVTSMLRGKKVMHLFE-EpSFDYLPGETVVIPSNVEMKIDFPEASLTNPTQCLALAIDQ 113 Flavo...
CCG53032                34 elnIFETYQESElVPLKFNDLVVTSMLRGKKVMHLFE-DpSFDYLPGETVIVPQNTEMKIDFPEASKDNPTQCIALAIDN 112 Flavo...
jgi:Ftrac_0953          55 eLNVFETHQQAKdVKLVFNDFVFTSMLRGKKVMHLEN-KeAFDYLPGESVIVGPNEVMEIDFPEAKKGQPTQCIALAISQ 133 Mariv...
WP_008199468            34 eLNIFETHQQADdVNLVFGDLVLTTMLKGKKVMHLFD-KpGFEYLPGESVIVPPNEVMKIDFPEAQWDNPTQCIALSISK 112 Algor...
kribb:DDD_3171          30 ELNIYETNDYAEkVALTFDFPVIASMLTGKKVMHIEG-FeAFDFFPGESVVMPRSKEMVIDFPLATKNSPTQCLALGIDA 108 Nonla...
Q3ID67                  29 elsIYDTYQNAQkVALHSKELLFCAMLSGKKVMHVEScQyHRAFLPHESFVLAPEQGVLIDFEQASLSAPTTCLAIEIST 108 Pseud...
PRJNA62513:MARPU_13645  14 eLSIYDTFAPARdVPLRADELLYCAMTQGRKRMHGPH-P-AHDFLPHQSYVLAPGEQVLIDFPEATLQRPTRCLTIAVER 91  Maric...
utah:Sant_P0086        105 YRVKATLeslaapsgdtaaavngssvalatgsaattgtgavvTAIDSg------------------------PLAQCILR 160 Sodal...
WP_052346121           111 DTIRQTV-----------------------------------DLLNEeqprseahlpwhldtldhahfqntpELTSTLER 155 Hymen...
WP_012779690           113 TKIQQIV-----------------------------------DRLSEtypregrqqfws-lqhnqyhflnniELAQTLNK 156 Dyado...
CCB70301               114 NKISETL-----------------------------------SFLNErypkegsstwql--dyqnyffynniELASTINK 156 Flavo...
CCG53032               113 KIITDTL-----------------------------------DFLNEkypkvgkdnlwk-ldhenyffynnvELASTINK 156 Flavo...
jgi:Ftrac_0953         134 QLIDFTL-----------------------------------DMLNEkhpkvieqdqwk-idpsihhiinnqELINTVDR 177 Mariv...
WP_008199468           113 EMIEATF-----------------------------------NLLNEkfpdkvitkdwg-ldlsyfhlintqDLSEIINR 156 Algor...
kribb:DDD_3171         109 FKINEVV-----------------------------------EKFNHhvaienennnws-ldekashlinneDVNHLIKR 152 Nonla...
Q3ID67                 109 DKITQVA-----------------------------------NALNIeqrfasddlfay--tpqlvhsqhnsQTQQLLAR 151 Pseud...
PRJNA62513:MARPU_13645  92 ERLRRLC-----------------------------------DRLDRhaplprgswqtv--hrhswhghhseATQGLLER 134 Maric...
utah:Sant_P0086        161 LVQLL-ETP-QAIRLLAPMALSELYYWLLTGPHGAH 194 Sodalis praecaptivus
WP_052346121           156 LVQLSrDTG-RVKDVLAGFTIQEMLVRLMQTQARQL 190 Hymenobacter swuensis
WP_012779690           157 LIKICsGSA-LGKDILADLTLQELIVHIIQTQHlaa 191 Dyadobacter fermentans
CCB70301               157 LIKECmSNS-ITKDALADLTLQELLIRIIQTQTsks 191 Flavobacterium branchiophilum FL-15
CCG53032               157 LIKECmGSS-LTKDVIADLTLQELIIRIIQTQtvkr 191 Flavobacterium indicum GPTSA100-9 = DSM 17447
jgi:Ftrac_0953         178 IIKISrTEDsSTKDLYVDLAMKEMIIRLMQTQARHv 213 Marivirga tractuosa DSM 4126
WP_008199468           157 FVRIGvKDGsKEKDLIATLALKELLIRLSQTQARDm 192 Algoriphagus machipongonensis
kribb:DDD_3171         153 LTYTFtNNN-KSKDVLLDLMIQELIVRLLQTRAktl 187 Nonlabens dokdonensis DSW-6
Q3ID67                 152 MVHLFsEPD-EQRGYLIDLSLNELITRLLQQQSRDL 186 Pseudoalteromonas haloplanktis TAC125
PRJNA62513:MARPU_13645 135 IAGSFlQAD-TDNDLVLDHGVDELLGRLLRQQGref 169 Marichromatium purpuratum 984
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap