2Z6B


Conserved Protein Domain Family
Gp5_OB

?
pfam06714: Gp5_OB 
Click on image for an interactive view with Cn3D
Gp5 N-terminal OB domain
This domain is found at the N terminus of the Gp5 baseplate protein of bacteriophage T4. This domain binds to the Gp27 protein. This domain has the common OB fold.
Statistics
?
PSSM-Id: 148361
Aligned: 9 rows
Threshold Bit Score: 193.074
Created: 22-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2Z6B_A    33 GLHPPQRAQGDVMGIPTEKLPWMSVIQPITSAAMSGIGGSVTGPVEGTRVYGHFLDKWKTNGIVLGTYGGIVREKPNRLE 112
Q19CN7     5 GIHPEQKVRADDYGLATEDLLWMSVGMPVTSASVSGVGQAPVGIVTGTHVYGIFLDEFYQNGLVLGTYPGIYPMMPDFNK 84  Aeromonas virus 25
P16009    33 GLHPPQRAQGDVMGIPTEKLPWMSVIQPITSAAMSGIGGSVTGPVEGTRVYGHFLDKWKTNGIVLGTYGGIVREKPNRLE 112 Escherichia virus T4
Q5QBY1    33 GMHPYEKVQGPVKGLRTEDLPWMSVLMPTSSASVSGIQTAMTGMVPGTQVYGHFLDKWKLNGLVLGTYGSASKQKANPNE 112 Escherichia phage JS98
QBO63097  33 GIHPSLSAHGDIQGLPTEDLLWITPVQDITSAAISGIGQSPTGIVEGSMVFGLALDERYLNCVILGTIAGQYTEKPLTTE 112
Q56BJ4    34 GEHPAQKQKSETIGIPVEELPWMIPIQDITSAAVSGVGFSPTGIVRGSFVVGYWRDKWHQDGVILGTYAGQYTEKPDTQK 113 Escherichia virus RB43
Q6WHG9    34 GLHPDKK--SSEQGIRTEELLWVHPMQSLDNAAMNGIGNAPIGVVEGTWVFGFFRDKLRQDAVAMGVLPGIPEDLPNGSV 111 Vibrio phage KVP40 ...
Q76YN5    32 GIHSNQKAKNDKNGIPTEELLWMHPMLPITSAAVSGIGQSPTGLLEGSHVVGYFRDKFCQDGVIVGSLPGIYKNKPDSSK 111 Aeromonas virus Aeh1
Q6U9G4    31 GIHPEQKVKAENYGMATDDLLWMTIGTSTTSASISGVGQSPTGIVEGTHVYGFYLDDFYQSGLIMGTYPGIYPEMPNFNK 110 Aeromonas virus 44RR2
2Z6B_A   113 GFSDPTGQYP---RRLGNDTNVLNQGG---EVGYDS--SSNVI-----------QDSNLDTAINPDDRPLSEIPTDDNPN 173
Q19CN7    85 GFSDPSREYP---RHVGSDVNILARGGkeiKISPGQivKENQIvpvv----vedQNLNRDVAQGADRTPNDEIYPNPDPD 157 Aeromonas virus 25
P16009   113 GFSDPTGQYP---RRLGNDTNVLNQGG---EVGYDS--SSNVI-----------QDSNLDTAINPDDRPLSEIPTDDNPN 173 Escherichia virus T4
Q5QBY1   113 GFSDPTGQYP---LYLGNDAAALNRGG---EVGYDA--TSNVI-----------QDANTDVGINPDGLDLSQVKPDDNPN 173 Escherichia phage JS98
QBO63097 113 GFCDPSGAYP---RYIGNDVNILARGGinpETGQTTkpDSVYI-----------RDENTGVAVNPDDEPLDQIPVDDNPD 178
Q56BJ4   114 GFCDPLGEYP---RYVGNDVNVLARGGldgKTS-----SSVVI-----------RDANSTLAVNPDDRPLDEIPEDNRPD 174 Escherichia virus RB43
Q6WHG9   112 GFNDPNEKYPladKLNEPDTNRLARNDvdpDVY---------------------DESQSQTAFDNGEAPYVY-----RPH 165 Vibrio phage KVP40 ...
Q76YN5   112 GFADPNGQYP---RYVGNDVNVLAGGG---QAGSGSsgSGAMVgpggepidvytQNENTGIAIKPDDTPAGEYIPDDDPN 185 Aeromonas virus Aeh1
Q6U9G4   111 GFTDPNRQFP---RYVGSDVNILARGGkeiKIAPGQiaQTEEIvpat----vedQDLNRDWAAEPNRTPNDEIKPNPNPD 183 Aeromonas virus 44RR2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap