2Z6B


Conserved Protein Domain Family
Gp5_OB

?
pfam06714: Gp5_OB 
Click on image for an interactive view with Cn3D
Gp5 N-terminal OB domain
This domain is found at the N-terminus of the Gp5 baseplate protein of bacteriophage T4. This domain binds to the Gp27 protein. This domain has the common OB fold.
Statistics
?
PSSM-Id: 148361
View PSSM: pfam06714
Aligned: 9 rows
Threshold Bit Score: 193.074
Threshold Setting Gi: 75081978
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2Z6B_A        33 GLHPPQRAQGDVMGIPTEKLPWMSVIQPITSAAMSGIGGSVTGPVEGTRVYGHFLDKWKTNGIVLGTYGGIVREKPNRLE 112
Q19CN7         5 GIHPEQKVRADDYGLATEDLLWMSVGMPVTSASVSGVGQAPVGIVTGTHVYGIFLDEFYQNGLVLGTYPGIYPMMPDFNK 84  Aeromonas virus 25
ADJ39865      33 GLHPPQRAQGDVMGIPTEKLPWMSVIQPITSAAMSGIGGSVTGPVEGTRVYGHFLDKWKTNGIVLGTYGGIVREKPNRLE 112 Enterobacteria ...
Q5QBY1        33 GMHPYEKVQGPVKGLRTEDLPWMSVLMPTSSASVSGIQTAMTGMVPGTQVYGHFLDKWKLNGLVLGTYGSASKQKANPNE 112 Escherichia pha...
LMGM:Phi1_49  33 GIHPSLSAHGDIQGLPTEDLLWITPVQDITSAAISGIGQSPTGIVEGSMVFGLALDERYLNCVILGTIAGQYTEKPLTTE 112 Escherichia pha...
Q56BJ4        34 GEHPAQKQKSETIGIPVEELPWMIPIQDITSAAVSGVGFSPTGIVRGSFVVGYWRDKWHQDGVILGTYAGQYTEKPDTQK 113 Escherichia vir...
Q6WHG9        34 GLHPDKK--SSEQGIRTEELLWVHPMQSLDNAAMNGIGNAPIGVVEGTWVFGFFRDKLRQDAVAMGVLPGIPEDLPNGSV 111 Vibrio phage KV...
Q76YN5        32 GIHSNQKAKNDKNGIPTEELLWMHPMLPITSAAVSGIGQSPTGLLEGSHVVGYFRDKFCQDGVIVGSLPGIYKNKPDSSK 111 Aeromonas virus...
Q6U9G4        31 GIHPEQKVKAENYGMATDDLLWMTIGTSTTSASISGVGQSPTGIVEGTHVYGFYLDDFYQSGLIMGTYPGIYPEMPNFNK 110 Aeromonas virus...
2Z6B_A       113 GFSDPTGQYP---RRLGNDTNVLNQGG---EVGYDS--SSNVI-----------QDSNLDTAINPDDRPLSEIPTDDNPN 173
Q19CN7        85 GFSDPSREYP---RHVGSDVNILARGGkeiKISPGQivKENQIvpvv----vedQNLNRDVAQGADRTPNDEIYPNPDPD 157 Aeromonas virus 25
ADJ39865     113 GFSDPTGQYP---RRLGNDTNVLNQGG---EVGYDS--SSNVI-----------QDSNLDTAINPDDRPLSEIPTDDNPN 173 Enterobacteria ...
Q5QBY1       113 GFSDPTGQYP---LYLGNDAAALNRGG---EVGYDA--TSNVI-----------QDANTDVGINPDGLDLSQVKPDDNPN 173 Escherichia pha...
LMGM:Phi1_49 113 GFCDPSGAYP---RYIGNDVNILARGGinpETGQTTkpDSVYI-----------RDENTGVAVNPDDEPLDQIPVDDNPD 178 Escherichia pha...
Q56BJ4       114 GFCDPLGEYP---RYVGNDVNVLARGGldgKTS-----SSVVI-----------RDANSTLAVNPDDRPLDEIPEDNRPD 174 Escherichia vir...
Q6WHG9       112 GFNDPNEKYPladKLNEPDTNRLARNDvdpDVY---------------------DESQSQTAFDNGEAPYVY-----RPH 165 Vibrio phage KV...
Q76YN5       112 GFADPNGQYP---RYVGNDVNVLAGGG---QAGSGSsgSGAMVgpggepidvytQNENTGIAIKPDDTPAGEYIPDDDPN 185 Aeromonas virus...
Q6U9G4       111 GFTDPNRQFP---RYVGSDVNILARGGkeiKIAPGQiaQTEEIvpat----vedQDLNRDWAAEPNRTPNDEIKPNPNPD 183 Aeromonas virus...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap