Conserved Protein Domain Family
DUF1199

?
pfam06712: DUF1199 
Protein of unknown function (DUF1199)
This family consists of several hypothetical Feline immunodeficiency virus (FIV) proteins. Members of this family are typically around 67 residues long and are often annotated as ORF3 proteins. The function of this family is unknown.
Statistics
?
PSSM-Id: 115374
View PSSM: pfam06712
Aligned: 5 rows
Threshold Bit Score: 71.4754
Threshold Setting Gi: 82291380
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q66976  1 MLPRNGDFVPDFIYRSNSIFTDSRRSGSMETSTISSPSRRIRNNFLGLLGTR 52  Feline immunodeficiency virus
P19031  1 MLDRNSKSVLVAFYRSGNIFRYNQCSDSMETSTISSPSRRIRNNFLGLLGTR 52  Feline immunodeficiency virus (isolate San Diego)
Q7LYZ1  1 MLYRNSRSVLASIYRSRNIFGNSQSSGSMETSTISSPSRRIRNNFLGLLGTR 52  Feline immunodeficiency virus
Q66955  1 MSHRNSGFVPA-FHRNNNIYTNNQGSGSMETSTIRSPRGRIRDNFLGLLGTR 51  Feline immunodeficiency virus
Q7LYZ2  1 MLHRNNGVVPASIDRNNNIYANNPGSGSMETSTISSPSRRIRNNFLGLLGTR 52  Feline immunodeficiency virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap