Conserved Protein Domain Family
DUF1195

?
pfam06708: DUF1195 
Protein of unknown function (DUF1195)
This family consists of several plant specific hypothetical proteins of around 160 residues in length. The function of this family is unknown.
Statistics
?
PSSM-Id: 399592
View PSSM: pfam06708
Aligned: 13 rows
Threshold Bit Score: 169.927
Threshold Setting Gi: 1002248730
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_015628530         4 LSAADSAASPATKItipyysAAAGAGEAGpPFGKGRYKVWALAAIALLALWSMSAASAS--LRWSSGrFLlaATASEDLD 81  Japanese ...
Q8LFK6               7 LPISTSSVAATTVT------GKKETGYSA-LFSKGRYKFWALAAILLLAFWSMLTGTVN--LRWSAG-NI--NHFTDDLV 74  thale cress
XP_006340593         6 LPISTPTAPSSSFTt-----SKKETSYSA-IFGRGRYKFWAFTAILLLAFWSMLTGTVT--LRWSAG-NL--NAISDDID 74  potato
XP_004234561         7 IPVSTPTTAYSSLNtn--siPSRSLHDAT-LFGRGRYKFWALAAILFLAFWSMCTGTVS--LRWSAG-NL--NSLSDLFD 78  tomato
ABK93535             7 LPTTTAPSV------------KKETSDSV-LFGKGRYKFWALAAILLLAFWSMLTGTVT--LRWSAG-NL--NSLVDDID 68  black cot...
XP_009402023         8 LPSFEATGGVASAI------RVSSAADAG-LFGKGRYKFWALTAILLLAFWSMVTGTVT--LRWSAG-DL--NRLDRDLN 75  wild Mala...
WGS:AAAA:OsI_26812   9 HHHHSSTPPPATKIsip-isAAGGGAEAA-LLGKGRYKAWALAAIALLALWSMFAASVT--IRWSSG-DL--AAAFGDLP 81  long-grai...
XP_002463166        14 HGLHSPTPASATKIsi-----pVSSGEAA-LFGKGRYKVWALAAIALLALWSMFAASVT--LRLSSG-EL--AATFGDVS 82  sorghum
EER94698             5 paDSAASPAPATKInmp-aaSAAGGAEAA-LLGKGRYKVWALAAIALLALWSMSAASVS--LRWSSSgDL--ASVYGDLD 78  sorghum
CBI17540             7 LPTTAPTTNA-----------KKDSSDAS-VFGRGRYKFWALAAILLLAFWSMFTGTVT--LRWSAG-NL--NHISDDLD 69  wine grape
XP_004238248        28 saVATPAAAAATST------VKKDQGFSG-VFGKGKYKLWVLAAILLLAFWSMFTGSLTlsLNWSTS-NL--SRLSHASD 97  tomato
XP_002320589        17 TSTSTPTTTTTTTV------VKRESSESS-LLCKTRYKFWVLSAILLLAFWSMFTGSIT--LKWSTG-DL--SQHPDNLG 84  black cot...
Q6NLX7               7 LPTTTTTGTATGTAma---nSKKESSDSV-LFGRGRYKFWAFAAILLLAFWSMFTGTVT--LRLSTG-NL--NRLSEDLG 77  thale cress
XP_015628530        82 APLLDDLDSLEMEEREKLVGRMWDMYTRTg-DEVRLPRFWQEAFEAAYEELAGDDMQVRDAAISEIARMSAHR-LELEQP 159 Japanese ...
Q8LFK6              75 FPIHEDLDVLEMEEREKVVKHMWDVYNNG--RRIRLPRFWQEAFEAAYEELTSDVPDVVEAAISEIARMSIRS-IVIDPP 151 thale cress
XP_006340593        75 IPLPEDLDVLEMEEREKLVKHMWDVYTNS--RGIKLLKFWQEAFEAAYEELTSDVPGVPEDALSEIAKMSVRY-IPIESP 151 potato
XP_004234561        79 IPKSDDLDVLEMEDREKLVNHMWDVYTNS--PRIRILKFWQEAFEAAYEELNSDVAEVREAAISEISKMSIQF-VNIDLP 155 tomato
ABK93535            69 TPIRDDLDVLEMEDREKVVKHMWDIYTNS--RRIRLPKFWQEAFEAAYEELTSDASDVKEAAIAEIAKMSIRS-IDLDPL 145 black cot...
XP_009402023        76 APIHSDLDALEMEEREKVVRHMWDVYAHN--HRIRLPRFWQEAFEAAYEELAGDDPAARDGAIAEIARMSVRM-VDLEDP 152 wild Mala...
WGS:AAAA:OsI_26812  82 DPLIDDLDPLEMEDREKLVRRMWDVYTRTgvDRVRLPRFWQEAFEAAYEELAGDDTQASETAVSEIARMSVHR-PELEQS 160 long-grai...
XP_002463166        83 DPLIDDLDPLEMEQREKLVRRMWDVYTRTd-NHVRLPRFWQEAFEAAYEELAGDDTLATDAAISEIARMSIHR-PEVEQS 160 sorghum
EER94698            79 VPLADDLDSLEMEEREKLVGRMWDMYTRTs-DEVRLPRFWQEAFEAAYEELAGDDVQVRDAAISEIARMSAHK-LELEQT 156 sorghum
CBI17540            70 SHIHDDLDVLEMEEREKVVKHMWDVYTNS--RRSRLPRFWQEAFEAAYEDLTNDDPGVREDAISEIVRMSVRN-IDLDPP 146 wine grape
XP_004238248        98 FTIHEDLDILVLEEREKMVKHMWDVYTQN--SRIRLPKFWQDAFQAAYLDLTSDSPATRDTAVSEIAKMSLRS-TSTYES 174 tomato
XP_002320589        85 FQTQDDVDILEVEEKKKLVWRMWDVYTHSs-RGTRLPRFWERAFQAAYEALASDVTAVRDAAVYEIAKLSISStINLDDP 163 black cot...
Q6NLX7              78 IPNYDNLDVLEMEEREKVVKHMWDVYTNS--RRIKLPRFWQEAFVAAYEELTSDVPGVREAAIGEIAKMSARS-ITLDPP 154 thale cress
XP_015628530       160 VN 161 Japanese rice
Q8LFK6             152 PL 153 thale cress
XP_006340593       152 PL 153 potato
XP_004234561       156 PL 157 tomato
ABK93535           146 PV 147 black cottonwood
XP_009402023       153 AR 154 wild Malaysian banana
WGS:AAAA:OsI_26812 161 SN 162 long-grained rice
XP_002463166       161 Wn 162 sorghum
EER94698           157 LN 158 sorghum
CBI17540           147 LI 148 wine grape
XP_004238248       175 PS 176 tomato
XP_002320589       164 fp 165 black cottonwood
Q6NLX7             155 PS 156 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap