Conserved Protein Domain Family
DUF1194

?
pfam06707: DUF1194 
Protein of unknown function (DUF1194)
This family consists of several hypothetical Rhizobiales specific proteins of around 270 residues in length. The function of this family is unknown.
Statistics
?
PSSM-Id: 369046
View PSSM: pfam06707
Aligned: 34 rows
Threshold Bit Score: 199.763
Threshold Setting Gi: 123590332
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q89Y61        88 AVDLELVIAVDISYSVQPDDLAAQREGYAKAIVSEEFLRALRTGPvGKIALTYFEWSSTRDQDVIVPWRQIDGPEAAEAV 167 Bradyrhizobium ...
Q28TF7        25 QCRLALQLGMDVSASVDQAEYRLQADGLAAALVDPIVTEAFLTGP-GPVALSIFEWSGRFQQDVLVDWTMITSEADLLAI 103 Jannaschia sp. ...
Q5LTZ1        23 ECRLALALALDVSRSVNAREDRLQRQGLAAALRAPEVVRAAFSTP-QPVALAAYEWSGPNDQHLLLDWVLLRTPTDLETA 101 Ruegeria pomeroyi
Q168W1        22 NCRLALLLAIDVSSSVDAAEDRLQRGGLVAALTAPEVQAAFFATD-QFVALAAFEWSGRYNQEILLDWTLIDSQMTLLDA 100 Roseobacter den...
Q2CF84        19 ECRLALVLALDVSSSVDAAEDVLQRDGLAAALTAPEVRAAFLAAD-LPVALAIFEWSGRYNQQLLLDWTLIDDDARLFAA 97  Oceanicola gran...
Q0FQW8        28 GCRLALLLALDVSSSVDEEEYRLQKEGLAAALADPDIARSILEGD-GRVALGVYEWSGRRQSTVVLDWTVLGDKPTLDQA 106 Salipiger bermu...
WP_006931208   9 ACSLSLVLAMDGSASVDAREHTLQLNGLADALTDPEVVQAIEAV--GGIWVTSFEWSGRYQQLLQLGWSHLNDAQSAAKA 86  Labrenzia aggre...
Q169U1        20 ACQLALVLAVDVSGSVDKHEYRIQMDGLAAGLRDGIVVDALLE---QEAMVTLIQWTGSSRQRQTIAWSALRVAEDVTRL 96  Roseobacter den...
Q5LXF1        19 ACDLALALAVDVSGSVDEGEYRTQMDGLAHALRDPVVSEALVR---AEAQLMLVQWTGSDRQRVTIPWTQASSFDALDRF 95  Ruegeria pomeroyi
Q2CFG2        20 ACDTALLLLMDVSNSIDVGEYRLQTDGLADALEDPEIAQAMLE---GQVALSVVQWSGPDDQAVSLPWTRMRTPADLAAF 96  Oceanicola gran...
Q89Y61       168 AAEIMKAPIRRGSR-TSISGAIKFAMPLFEQNPYRGARRIIDVAGDGPNNNG-DPVaTARDTAVQQGIVITGLPVMINAT 245 Bradyrhizobium ...
Q28TF7       104 AERIAGRSRGSQDFpTALGYALGFAATRFREAPV-CLFQTLDISGDGQNNDGfPPV-AAFEHFDFDGITVNGLAIGGASR 181 Jannaschia sp. ...
Q5LTZ1       102 AARLGASRRATTEApTAMGHALTYGAALLGRGPD-CLFRTIDLSGDGENNEGfGPR-AAYSTPEFDGITVNGLAINGAEY 179 Ruegeria pomeroyi
Q168W1       101 AGTIANSTRSHNDFpTAMGYALGYGAGMLERAPA-CLYKTLDMAGDGQNNEGfSPA-QAYAAFPFDDVTVNGLVVNGADF 178 Roseobacter den...
Q2CF84        98 ADRLARSSRHADDSpTALGHALGYGAGLLARAPD-CLFETIDVAGDGVNNEGfPPA-AAYRHFPLADVTVNGLAIGDAEA 175 Oceanicola gran...
Q0FQW8       107 IGQILAAPRSHNRFpTAMGYALGYGSAMLDRAPV-CARRVIDVSGDGITNDGfRPQ-QAYLHFPFGEVTVNGLAVLGSDP 184 Salipiger bermu...
WP_006931208  87 AEILRRAPRGYTEFpTALGYALGHASTLMRKAPVPCGRKVVDVAGDGINNDGfGPD-SAYRAFDFKEITVNGLVISGADQ 165 Labrenzia aggre...
Q169U1        97 ADRIAADERVWRNYsTAIGEALIAAEQALKSVPH-CARKVIDVSGDGISNEGaAPA-SRRAALSALGVTVNALAIETDED 174 Roseobacter den...
Q5LXF1        96 ADRVAADPRIWRNYsTAIGEALEVTMAAFAQVPD-CARHLIDVSGDGPSNEGiEPL-AVHRDLRALGITVNAIAIEQSEP 173 Ruegeria pomeroyi
Q2CFG2        97 AARARAMRRAFRLSdTAPAEALTFALAHMAQAPP-CARRIVDISGDGMANAGgEVR-GLPARAERQQVTINGLAIEGMGV 174 Oceanicola gran...
Q89Y61       246 PPGQvdishidHIDWYYEDCVIGGPGSFVVPITDRENFKEAIRTKLALEVAGRT 299 Bradyrhizobium japonicum
Q28TF7       182 -----------EIEDYFAAEVIRGPGAFVEYALNHDHFAEAMRRKLERELRAMI 224 Jannaschia sp. CCS1
Q5LTZ1       180 ETEI-------QLIPYFRSEVLHGPGAFLEVAQGFADFERAMRRKLERELSGLV 226 Ruegeria pomeroyi
Q168W1       179 EAET-------GLIAFYKGQVMRGPGAFVEIAQGFEDYERAMRRKLERELTPPV 225 Roseobacter denitrificans OCh 114
Q2CF84       176 G----------GLPGYYRAELIGGPRAFVEVAADFADYERAMRRKLLREVAATP 219 Oceanicola granulosus HTCC2516
Q0FQW8       185 -----------RVVEYFRGEVAHGPGAFVEVAQGYSDFRRAMTLKLFRELNDMI 227 Salipiger bermudensis HTCC2601
WP_006931208 166 -----------TPVRYYRTHVIKGPGAFVEVAASYDDYAEAMKRKLLREIFGSG 208 Labrenzia aggregata
Q169U1       175 -----------DLTGWFYENLIHGEGAFVMTANGFEDYPAQIKRKLQRETTRQL 217 Roseobacter denitrificans OCh 114
Q5LXF1       174 -----------DLTAYFYENVIVGEGAFVETANGFADYPARIRKKLLREVTQQT 216 Ruegeria pomeroyi
Q2CFG2       175 -----------AVTTFYRRALITRDG-FVITARGHREYPEAIRRKILREVSRIF 216 Oceanicola granulosus HTCC2516
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap