Conserved Protein Domain Family
CTV_P6

?
pfam06706: CTV_P6 
Citrus tristeza virus 6-kDa protein
This family consists of several Citrus tristeza virus (CTV) 6-kDa, 51 residue long hydrophobic (P6) proteins. The function of this family is unknown.
Statistics
?
PSSM-Id: 115368
View PSSM: pfam06706
Aligned: 2 rows
Threshold Bit Score: 72.6818
Threshold Setting Gi: 81946633
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8B3T6  1 MDCVIQGFLTFLVGIAVFSAFAGLIIIVITIYRCTIKPVRSASPYGTHATV 51  Citrus tristeza virus
P87590  1 MDCVIQGFLTFLVGIAVFCAFAELIIIVITIYRCTTKPVRNASPYGTHATI 51  Citrus tristeza virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap