5YH3,5WRR,4KQB


Conserved Protein Domain Family
Fam20C

?
pfam06702: Fam20C 
Golgi casein kinase, C-terminal, Fam20
Fam20C represents the C-terminus of eukaryotic secreted Golgi casein kinase proteins. Fam20C is the Golgi casein kinase that phosphorylates secretory pathway proteins within Ser-x-Glu/pSer motifs. Mutations in Fam20C cause Raine syndrome, an autosomal recessive osteosclerotic bone dysplasia.
Statistics
?
PSSM-Id: 399590
View PSSM: pfam06702
Aligned: 51 rows
Threshold Bit Score: 279.475
Threshold Setting Gi: 1573743655
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5YH3_C       213 FFISPANNICFYGECsYYCSTEHALC-GKP-DQIEGSLAAFLPDLSLAKRKTWRNPWRRSYHKRKKAEWEVDPDYCEE-V 289
1_pfamImport   1 FREKD-GNTCYFGVC-LYCNERNMAC-GEG-GLMEGSVTLWLPPKWSAFQ-KQRHPYQRTYVDGRKARWENDGRYCNDvV 75 
XP_001636304 171 FFKKG-GNTCFYGVC-YYCNKEEAAC-ANK-TSMEGSMTIWLPQGWA-LR-KWRHPWQRTYNNRK-ASWELDNNHCKK-V 242 starlet sea ane...
XP_028035920 215 MVKNEVGATCIYGKC-YYCKINETVC-PDNtGVLEGAAILYLEKQFK----VHKSPWRRSYSRKKMD-WEKDTDFCKK-L 286 wild silkworm
XP_001946665 226 YINSTTKETCVYGKC-YYCKREDPVC-TKS-ERLEGAAIFHLP--SNIKLKQHLHPWRRTYIENKRARWEDDNDYCDS-I 299 pea aphid
XP_001599070 232 IFTKY-NDTCIYGVC-HYCSSAEPIC-GID-NILEGSVILWLPSSWR-LI-KYKHPWQRTYSESRLARWEVDMNYCGK-V 304 jewel wasp
XP_006569904 241 IYQDG-NDTCLYGVC-HYCSPADPVC-GVG-DILEGALISWLPRYLK-LV-KHRHPWQRTYKKNKLATWETDDNYCEK-V 313 honey bee
XP_002425587 206 FYDDG-NNTCFYGVC-LYCEPKSLVC-AKN-DIMEGALIMWLPTKIK-FK-KYPSPWQRSYKSNLVARWEMDENYCSD-V 278 human body louse
4_pfamImport   1 FYKNG-NNTCFYGVC-IYCKPDDGVC-AKG-SFLEGSIALWLPNKWE-TR-RARHPWQRTYNKNQ-AMWEMYTEYCDV-I 72 
EFX64528     234 FFKNNQSHSCFYGVC-RYCKPELSVCgGEG-DLIEATVILWLNDVK--LK-SNRSPWQRTYKKNVRALWETDDDFCIKlQ 308 common water flea
5YH3_C       290 KQTPPY--DSSH-RILDVMDMTIFDFLMGNMDRHHYETFEKFGNETFIIHLDNGRGFGKYSHDELSILVPLQQCCRIRKS 366
1_pfamImport  76 KRQAPY--DRGT-RLLDVADAAVFDYLIGNADRHHYEIFKNKSKDTMLIMMDNAKSFGNPHHHEPSILAPLKQCCILRRS 152
XP_001636304 243 IQQSPY--DQGP-RLLDIIDTAVFDFLIGNADRHHYETFKKGDDEGMLVHLDNAKSFGNPDHDELSIAAPLYQCCQLRDS 319 starlet sea ane...
XP_028035920 287 SH------TLSLqRILNLIDVAIFDFLIQNGDRHHYEVY-----KNRIVILDNGKGLGNPMVDILDVLAPLYQCCIINLQ 355 wild silkworm
XP_001946665 300 KS------NYNSeRILDFIDVSIFDFIIGNGDRHRYEVVEQF--NNTILLIDNGKSFGNPYKDHIDILAPLYQCCIIRLK 371 pea aphid
XP_001599070 305 QRSKIYslDYSI-RLLDLIDVAIFDFLMDNGDRHHYEILKNNDKNSAILLIDNGKSLGNPDLDHIDILAPLYQCCLIRKA 383 jewel wasp
XP_006569904 314 KDSKAYspQTSS-RLLDLVDTAIFDFLMDNGDRHHYELAQNNFHNPAVLLIDNGKSLGNPDIDHFDILAPLYQCCMIHKT 392 honey bee
XP_002425587 279 KNSKQ---NNQN-RLLDLTDAAIFDFLIDNGDRHHYEVPLGFN-HSSIFLFDNGKSFGNPYIDHIDILAPLYQCCVIRKS 353 human body louse
4_pfamImport  73 KKAKPY--KDER-KLLDLVETSVFDFLIDNGDRHHYEHFSHE--RSKVLLIDNAKSFGNPYVDHIDILAPLYQCCRIREK 147
EFX64528     309 KQNKVFrlEAGKrRLLDLIDASVFDFLISNGDRHHYEIIDGYS-EAAVLLLDNGKSFGRPDLDYVDILAPLYQCCVIRKS 387 common water flea
5YH3_C       367 TYLRLQLLAKEEY-KLSLLMAESLRGDQ----VAPVLYQPHLEALDRRLRVVLKAVRDC-VERNGLHSV 429
1_pfamImport 153 TWEKLQQLKNG---VLTQLLESILSADP----ITPVLHPPHFNAIDVRLPTIIETMEKC-IKDKSYDDV 213
XP_001636304 320 TYKRLKEIANNKVkPVGELLKEATSSDA----LAPVLTEPHFKAVTRRLSIVMDIVTRC-IERNGRRKV 383 starlet sea anemone
XP_028035920 356 TWQNLQLLSGG---SLTETIKILSSFQG-----EKLATEEHFEAIERRLLKVYATVQYC-IEKYGTEKV 415 wild silkworm
XP_001946665 372 TWERLKSIKGG---TFTNILQSMLDVHE----TLSLLTLPHYRALERRLKIIYATVVMC--QKKSDRSI 431 pea aphid
XP_001599070 384 TWKRLQLFSGG---SLGYALNELLAHESskanVLPLITNEHLNAIERRLLTVFGVVEFCiHKNQYPANV 449 jewel wasp
XP_006569904 393 TWDRLKLFSGG---TLSIALSKLVAHESimadVQPLITEVHLNAMDRRLLTIYAVVEYClKNKKYASNV 458 honey bee
XP_002425587 354 TWERLKMFSGG---LLSSSLRNLLKYSD----ITPVLTNSHLFALDRRQLFIFAAVEMC-ITQYGESKV 414 human body louse
4_pfamImport 148 FVSVLISLKG----KLGYWLQKLMESCS----LAPILTKDHLNAMDRRLNSVLATIMVC-IKSKSIDEV 207
EFX64528     388 TFKRLEMLESG---PLGTLIEELTLKDSl---IGPLLTEEHVQAINRRLGKVMRTIQLC-AQVKSWDDV 449 common water flea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap