Conserved Protein Domain Family
Plant_NMP1

?
pfam06694: Plant_NMP1 
Plant nuclear matrix protein 1 (NMP1)
This family consists of several plant specific nuclear matrix protein 1 (NMP1) sequences. Nuclear Matrix Protein 1 is a ubiquitously expressed 36 kDa protein, which has no homologs in animals and fungi, but is highly conserved among flowering and non-flowering plants. NMP1 is located both in the cytoplasm and nucleus and that the nuclear fraction is associated with the nuclear matrix. NMP1 is a candidate for a plant-specific structural protein with a function both in the nucleus and cytoplasm.
Statistics
?
PSSM-Id: 369039
View PSSM: pfam06694
Aligned: 4 rows
Threshold Bit Score: 550.304
Threshold Setting Gi: 302807662
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ERN18873       5 MEEIQLKLAALNYPRANVPAQSLLFAGMERYGLLEWLFFRLLGDKPPFTQQNLQADGMVNDEETSRIQYLAEIANFLGIT 84  Amborella trich...
Q94G01         6 MEEIQRKLSLLEYPRANAPAQSLLFAGVERYRLLEWLFFRLLGDRSPFTQQNWQGDSLDRDEENNRIQHLAEIANFLGIT 85  Zea mays
Q93XE2         6 MEEIQKKLATLNYPRANAPAQSLLFAGMERYALLEWLFFKLLGDKSPFSQQNLQGDAVDRDEETSRIQYLAEIAKFLGIT 85  tomato
XP_002985525   1 MEEVQSKLMALDYPRASVPAQSLLYAGLERYALLEWLFFKLLGDKSPFTQQGAQGDGTERDEESTRTQHLAEIARFLGLT 80  Selaginella moe...
ERN18873      85 PTIDTEAIQGRGSYEDRAEMLRNIVDLVEASFTSDHPEWSVDEQVAKDIQLLDSIAEKQAQIFSEECKLFPADVQIQSIF 164 Amborella trich...
Q94G01        86 PSADTEAIQGRGSYEERVELLHLIVDLVEASCYADNPEWSVDKQLEKDVQLVDSIAEKQAQIFSEECKLFPADVQIQSIY 165 Zea mays
Q93XE2        86 TTVDPEAIQGRGSYEDRMEMLRLIVDLVEASMYADNPEWSVDEQVAKDIQLIDAIAEKQSQIFSEECKLFPADVQIQSIY 165 tomato
XP_002985525  81 PTVDLDAVQGKGSYESRAEMLRLIVNLVEASCVADNPEWSVDDQVAKDIQFLDAISEKQAQVFSEECKLFPPDVQIQTSF 160 Selaginella moe...
ERN18873     165 PLPDIAELELKLSEHSKQLSSLQQAVQELASKHAYNPDEEYAEAELKLRMQLESFLETARSFNLIYTKEIRPWTHMMEVP 244 Amborella trich...
Q94G01       166 PLPDIAELELKLSEYTKKMSNLQQMVQELASKYDYNPNEDYAETELKLREYLQSFLETVKSFNTIYTKEIHPWTHMMEVP 245 Zea mays
Q93XE2       166 PLPDISDLEKQLSDQSNRLLSLQEMVDDLASKHPYNPDEEYVDVEAKLRGHLESFLDTARTFNTIYTKEIRPWTHMMEVP 245 tomato
XP_002985525 161 PVPDVSELENKLADYVKHLADLQQVVDDLASKQNYNPNEDHSEAGNELKAQLESFLETAKVFNHIYSKEIRPWTHTMELP 240 Selaginella moe...
ERN18873     245 QLHGFGPAANRLLEAYKMLLKFLCNLRNLRDSHAAVAVGSEStVDDAPrreSTVTRIIAECESALTFFNRDLSVLSASLA 324 Amborella trich...
Q94G01       246 QLHGFGPAANRLLEAYNTLLKFLGNLRSLRDSYTAMAAGSLS-ASNEP---SSVTKIISDCESALTFLNHSLSILSTSVA 321 Zea mays
Q93XE2       246 QLHGFGPAANRLLEAYKMLWKFLGNLKNLRDSHAAVAAGSSEtVAGEP---SSVTRIISECETALTLLNRDLAILSASIA 322 tomato
XP_002985525 241 QLHGLGPAANRLLESYKLLLKLLRNLRSLRDSHAAIAAVSET--STSP---TATSKLVSECEEALVDLNRGLAVLSASAA 315 Selaginella moe...
ERN18873     325 RE 326 Amborella trichopoda
Q94G01       322 RE 323 Zea mays
Q93XE2       323 RE 324 tomato
XP_002985525 316 Rv 317 Selaginella moellendorffii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap