5D4T,5O4M


Conserved Protein Domain Family
DUF1188

?
pfam06690: DUF1188 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF1188)
This family consists of several hypothetical archaeal proteins of around 260 residues in length which seem to be specific to Methanobacterium, Methanococcus and Methanopyrus species. The function of this family is unknown.
Statistics
?
PSSM-Id: 399582
Aligned: 11 rows
Threshold Bit Score: 317.693
Threshold Setting Gi: 19886277
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5D4T_F             7 KYGITEXVKTIDTKTRVVDVTNEIAKKKYQAIRDFLEGEEF---KEVVIFGVYLWGNYTAQXLSKYaDKVYLVDIHEFXK 83  Methanocald...
WP_015284880       8 EYGITHAVRTCTSRVMLAHVMNSVISTKARAVAAWLADRGRe-pRNALIIGTYLTGAGIANRLIGK-CPVTVLDVHPHLN 85  Methanoregu...
jgi:Mfer_0770      7 ENGITPTVKTYYSEYTFHDIIKYIGEVKTKAVIKWLKEKKLk-pKNCLIIGGYITGSFLANNLN---TEITLVDIHPQVI 82  Methanother...
Q7LYQ0             5 ETGITETVKTFFSSLTVGDIVRRISHLKSSAVTGWLDDARFe-pENALIIGSYFTGAAISGALD---CRVTVADINPQTR 80  Methanother...
jgi:Mpet_1997      7 EYGITRTVRTFFSKYTICNIVDGITEKKSDALLRWMNENGIc-pENVLVIGAYLTGAGLSKALSKK-SEVTVLDINSEIK 84  Methanolaci...
AAM01231           5 EPGITDLTETVRSR-PFWDVVKEIGLAKAEEIAEVVPe-----gSRILVLGAYLTGIFVAELLSEE-HEITVLDPEPALR 77  Methanopyru...
WP_013180472       2 KYGITENVKTIESKVKVRDIIKKIAEKKANAIKYYLEGEEF---EQAIIFGAYLSGNYIANTLKADcGEVILIDSQPHLE 78  Methanococc...
WP_011973998       2 KYGITETVKTINSKIKINDIIYNIVEKKANAIKYFLEGEEF---NQAIVFGAYLCGNFVADALTKDcDEVILVDVHPHLK 78  Methanococc...
5O4M_C             2 NYGITESVKTTRSKIKIKDIVSDVVEKKANAIKYFLEGEEF---KQAIVFGAYLSGSYIAYSLLKDcEEVIIVDIQPHLK 78  Methanococc...
NZAGRC:Abm4_0010   4 DTGITTEVYTIKSKTRLIDIFDEIISKKSSVTLDYVNSLDLdrdSNIIVVGTYFTGLGIVKKLSRYyNNITLIDIYPHLE 83  Methanobrev...
WP_011834104       3 ETGITSSVITITSTLREYDLANEIAAKKADTVLAWIEKEHLs-lSNVLIFGLYFTGAALASRLDKK-AKVTVIDIYPHLA 80  Methanocorp...
5D4T_F            84 GFVPNNnsikflnlNEFKLKFIRG---EVNPDLIVDLTGLGGIEPEFLAKFNP-KVFIVEDPKGV-FDVDIYEADNTYKR 158 Methanocald...
WP_015284880      86 CLLHPG--------VSFTTSLEEVt--GRTWDFVMDTSGIGGISPEDIHRLPRcRTFVTEDPASDgSDTMIRQVRQCWER 155 Methanoregu...
jgi:Mfer_0770     83 NLVEKN--------IEFKIGLDGL---RKKWDLIIDTTGIGGI--ENLNKFYT-KAFIIEDPRSDgSDKTIRKIGSKKRL 148 Methanother...
Q7LYQ0            81 FLLRGD--------VDFREGIHGL---NGDWDLIVDTTGIGGVTPEELSGFTA-GAFIVEDPTSDgSDETIMGYNSTAER 148 Methanother...
jgi:Mpet_1997     85 NLLDPD--------VTFSCNIDEAv--SRNYDMIIDTSGFGGIDPDKLQMLNSpEVFIVENPCSEgSDNFLNRFNRSVQL 154 Methanolaci...
AAM01231          78 KILPPG--------VRFRASRVPP---PGRYDVVIDLTGLGGTNPRVLRRLNP-EVLVVENPAGNmNDPRIEEYNDTEER 145 Methanopyru...
WP_013180472      79 DIVTGNgikf-mdlNTFMLKLRNNkdkEINPDLIIDVTGLGGVDPNMLKDFDP-KVLIIEDPKSS-FDKELMEADNTHKR 155 Methanococc...
WP_011973998      79 EIIINEkikf-mdsSKFNLSLRNG---ELNPDLVVDLTGIGGLSPEIISKLNP-SVLIVENPKGT-FDKDINNIDNSVDR 152 Methanococc...
5O4M_C            79 DILFNDgikf-mdlNKLQLELRNGt--SINPDLVIDLTGIGGVSPDLISKFNP-KVLIVEDPKGN-HDKGISKIDNTDKR 153 Methanococc...
NZAGRC:Abm4_0010  84 ELLHADiggelycdVEFSSNLDLI----YAADVLIDTTGFGGLTVKQSSKLNL-KGFIIEDPVAEdNDELLKDKNNIHKR 158 Methanobrev...
WP_011834104      81 ELINGR--------IDFFTHISEVp--CRRWSLIIDTTGLGGVDKQTLSSLYC-DALIVEDPCSDaSDMCICSASNRREI 149 Methanocorp...
5D4T_F           159 TApFIEKAKVGVLKTyrKARVSKTSGTXTLTIDTIVDASREITSLDGVLYAIPNLRYYEGILFHENDIHKFLSEI-SQPA 237 Methanocald...
WP_015284880     156 AG-SIRADEKGILHT--SGLAAKTSGTMTLSMGVLRHAMAAAHRQEGVLYCTAPMEFSERILFGDRDPARFFESL-ERPA 231 Methanoregu...
jgi:Mfer_0770    149 ID-SINAKYKAFLYT--YGLQSKTSGTMTLTIEVLKNVMNYFFDVEGVLYCMSPFEFYEGMLFKENNFTKFMKKL-KKHA 224 Methanother...
Q7LYQ0           149 LE-AVEADLKASLRT--LGLGAKTSGTMTLTVEVLRRSMADALECRGVLYATATLRFFERILFRERDPQGFLRAL-ESPA 224 Methanother...
jgi:Mpet_1997    155 LR-SSKAENKGILWT--SGLNSKTSGTMTLTIDTLRRSMNDANKINGVLYSTTNMEFFERILFKEKNPDKFLKTL-DKKA 230 Methanolaci...
AAM01231         146 LE---AGEESYELRLfdAPFEAKTSGTFTLSVRTVREAANRLERHYGVLYAVPGVVNLERWTFRLRRPEEGVERArEKPA 222 Methanopyru...
WP_013180472     156 LC---VGHKKGSLKTfrSSKISKTSGTMTLTVDVIMDSCIEIKELDGVLYSVPNLEYFEGIVFHEKDVRKFLREV-NTPA 231 Methanococc...
WP_011973998     153 LN---KGVKRGLLNTfrTSKVSKTSGSMTLVIDTVMDSCNDLKELDGVLYALPNLKYYEGILFHEKDIRKFIDEV-NTPA 228 Methanococc...
5O4M_C           154 LC---VGAKKGVLKTyrSSKFSKTSGTMTLVVDIIMDSCREINELDSVLYTIPNLKYFEGTVFHEKNVKKFLTEL-NMSA 229 Methanococc...
NZAGRC:Abm4_0010 159 LE-VVNSPNKAIIKT--KGINTKTSGTMTLTIGVLTDVLNKAQNMDGVLYSACEMTFYEEIIFKERNIEKFMNLA-LRQA 234 Methanobrev...
WP_011834104     150 LM-NHSAPKKGLLTT--TGLNTKTSGTMTLTVAAARHAAAEAEKLCGTLYAVSAADFPERILFKERDMLQFQAVM-SQPA 225 Methanocorp...
5D4T_F           238 ITISTLNd-vLDEAEEILSNNINLIYSFV 265 Methanocaldococcus jannaschii
WP_015284880     232 LTVSSLT---DVDCDALVWGTLERLKSYV 257 Methanoregula formicica
jgi:Mfer_0770    225 LIVSSLR---PVSCDKVIEKFIKKIKSKV 250 Methanothermus fervidus DSM 2088
Q7LYQ0           225 LTVSSLG---DISCDEILEGNLGMIRSEV 250 Methanothermobacter thermautotrophicus str. Delta H
jgi:Mpet_1997    231 LAVSSLI---ETDCDEIIDSNLKKINSTI 256 Methanolacinia petrolearia DSM 11571
AAM01231         223 VTVSQLTg--SSDPDEVIGEVLDEILFEI 249 Methanopyrus kandleri AV19
WP_013180472     232 LTVSCLGn-lEAEIDEIIDKNMQKVYSFV 259 Methanococcus voltae
WP_011973998     229 ITVSCLDedlENEINNILLKNIDRIYSYV 257 Methanococcus aeolicus
5O4M_C           230 ITVSSIDh-vEYELEEILSKNISRVDSFV 257 Methanococcus maripaludis S2
NZAGRC:Abm4_0010 235 LKISTIN---PFDCDKLLKDELDKIHSEI 260 Methanobrevibacter sp. AbM4
WP_011834104     226 LRISSLK---EIDVDAVLRESLSLIRTEI 251 Methanocorpusculum labreanum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap