Conserved Protein Domain Family
DUF1178

?
pfam06676: DUF1178 
Protein of unknown function (DUF1178)
This family consists of several hypothetical bacterial proteins of around 150 residues in length. The function of this family is unknown.
Statistics
?
PSSM-Id: 399575
Aligned: 108 rows
Threshold Bit Score: 144.656
Threshold Setting Gi: 123647009
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_014249005        1 MILFALRCSADHRFEAWFRNGAAYDEQAAAHQIACPICGDTVVGKAPMAPRIAKGVARAADRARDQAEavaanappsaap 80  Azospirill...
Q21YB2              1 MKVLDLQCHNQHVFEGWFASESDFLDQCGRGLVECPVCGDGSISKRLSAPRLNLGGGRGEPSPALDVArpdga------- 73  Rhodoferax...
CAP43711            3 LKVFDLQCDQGHLFEGWFGSHDDYDAQQARGLVTCPMCASAQITKRLSAPHLNVAHLHAPPPAAAGAAapndpa------ 76  Bordetella...
Q2KX93              3 LKVFDLECEHGHLFEGWFSSHDDYDAQQNRGLLSCPVCASRSIVKRLSAPRLNVAHLHQPSAQTSPQAl----------- 71  Bordetella...
Q7VX20              3 LKVFDLQCEQGHVFEGWFGSHEDYDAQQARGQIACPVCESSRITKRLSAPRLNVAHLHQPAAAPAPAPapapese----- 77  Bordetella...
WP_043683662        3 LKVFDLSCEHDHVFEGWFSSQDSYQDQLARGLVRCPVCHSGQITRRVSAPHLNVSHLRAEPAPRAESApqaraavaa--- 79  Castellani...
WP_013741490        3 LKVFDLQCDQDHVFEGWFSSADNYESQQSRGLLNCPVCNSHQISKKLSAPRLNVSHIKGAAEPVTGASgavaaps----- 77  Pusillimon...
Ansesd:TEQUI_1210   3 LKVFNLSCEHGHDFEGWFESLEALEKQASLGLIECPHCQTSKVFKTVSVPHFSSSTIKTTKVEPEVNTe----------- 71  Taylorella...
BAL25129            1 MIVLNLSCDREHQFEGWFGSADAFESQRETGQITCPVCGSAVISRRPSAPYVNTGAVARAEPKAAAAPehrgeaa----- 75  Azoarcus s...
WP_004324898        1 MIVLDLHCSNAHRFEGWFGSAAAFEAQLADRLVNCPICGATEVRRLPSAPYVQTGQSASARPPAAGEVqaasavpp---- 76  Thauera
WP_014249005       81 aapsnaapatlpapipapvplpsaadmvaalppslndaqREAVAEVMRQLTEVRRSVEKNCDYVGDRFAEEARRIHYGET 160 Azospirill...
Q21YB2             74 ------------------------------------------eqalQLAWMAMAHRIVANTDDVGDRFAEEARKIHYGEV 111 Rhodoferax...
CAP43711           77 -----------------------------------------avarlQAAVLQQIRDIIRKTENVGPRFAEEARRIHEGDA 115 Bordetella...
Q2KX93             72 ----------------------------------------------QAEALRQMRKWVSQTENVGPAFAVEARRIHEGEA 105 Bordetella...
Q7VX20             78 ---------------------------------------aarmarlQAAVLRQVRELVRNTENVGARFAQEARRIHEGEA 118 Bordetella...
WP_043683662       80 -------------------------------------psgdqmarlQAEVLRQIRRIVRQTDDVGARFADEARRMHSGEI 122 Castellani...
WP_013741490       78 ---------------------------------------asqvaqlQAQVLRHVRQIIRNTEDVGVRFAEEVRSMHDGET 118 Pusillimon...
Ansesd:TEQUI_1210  72 ---------------------------------------SPITEEVVAEVFKAIEKAITSAEDVGDGFTDVVIRIHKGEE 112 Taylorella...
BAL25129           76 ---------------------------------------pplnpdaVATVLAMMRRIGRESEDVGERFPDEARRIHHGES 116 Azoarcus s...
WP_004324898       77 ---------------------------------------sapapegLARLMTQLRSLARVAENVGERLPEEARRIHYGET 117 Thauera
WP_014249005      161 DPRGIYGEASDDEVAELHEEGVTFHRIPWI-PR 192 Azospirillum lipoferum
Q21YB2            112 KERGIRGHASRAEAESLIEEGISVMPLSLP-AA 143 Rhodoferax ferrireducens T118
CAP43711          116 DDRPIRGTATAEERLALSEDGIEVMALPDFldd 148 Bordetella petrii
Q2KX93            106 AERPIRGTATPEERAELADDGIHVLPLPSFldd 138 Bordetella avium 197N
Q7VX20            119 DERPIRGTATPQERAELADDGIDVVSLPAFlDd 151 Bordetella pertussis
WP_043683662      123 EERPIRGTASAEECRELVEEGISIMPIPDIlDd 155 Castellaniella defragrans
WP_013741490      119 EERAIRGVATSEEREELAKDGINVMPIPDF-Ld 150 Pusillimonas sp. T7-7
Ansesd:TEQUI_1210 113 PARAVRGRASIKQREMLEKEGIATLAYPdfmdp 145 Taylorella equigenitalis MCE9
BAL25129          117 EARNIKGQASGSEVRELIEEGIMVLPLPSdegl 149 Azoarcus sp. KH32C
WP_004324898      118 EARDIRGSASADEVESLLEEGILVLPVPPAeEd 150 Thauera
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap