Conserved Protein Domain Family
DUF1177

?
pfam06675: DUF1177 
Protein of unknown function (DUF1177)
This family consists of several hypothetical archaeal and and bacterial proteins of around 300 residues in length. The function of this family is unknown.
Statistics
?
PSSM-Id: 399574
Aligned: 31 rows
Threshold Bit Score: 360.406
Threshold Setting Gi: 74541986
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Elen_3066  41 LEGPKGSTDMVRVRIPGSRGRAAGGEAPTIGLLGRLGGLGARPERIGFVSDGDGALTALACAAKLLSMHARGDVLPGDVF 120 Eggerthella le...
Q0K4Y5         19 T------TDFITIVIPGTTGKRSGGSAPTLGVIGRNGAIGARPELVGLVSDADGPIGCLAVALKLAQMKARDDHLAGDVI 92  Cupriavidus ne...
WP_011811021   45 EEDATRTTDFIRILIPGRNGATSGGTAPTIGLIGRCGAMGARPHRIGLVSDADGVLAALVCALKLSHMKAKGDAIEGDAL 124 Verminephrobac...
Q0K9C4         40 VEENGLYTDFLACTVPGQN-----PDAPALGVVGRLGGVGARPAVTGLVSDADGAIVAVASALKLADMAATGDVLAGPVR 114 Cupriavidus ne...
WP_012186862   52 IKGNDGSVDLVTILIPGAQGKKLGGTAPTLGITGRAGGISARPTIKGLVSDADGVITALAVAYKIAEMARRGDALPGDVI 131 Caldivirga maq...
Q4J7P2         28 eeKQLGEVTYIKCLYRG-------RGKDRVEVLGRLGAIQVRQE-KGLVSDADGAIVSLTVLFELLNLREKGVELNVDVS 99  Sulfolobus aci...
WP_010923082   32 eEKKIGEVTFVKVYYGS-------GGREKVEILGRLGAIQMQNASKGLVSDADGAIVTLAVLLELLNLKEKGIALDLDVS 104 Saccharolobus ...
Q97ZB8         33 EEIKAGEVTFIKALYEG-------VGNNKVEILGRLGAIQMVGVNKGLVSDADGAIISLAVLLELLNLRDKGIELNLDVL 105 Saccharolobus ...
WP_014730786   39 VGSEKGSTDIVRILIEGED-----PSLPVLGVIGQLGGIGARPEMIGFVSDGDGAAAALALALKAAQASDKGDRLPGNLY 113 Mesotoga prima
WP_012002130   39 ITTSRGKTDIVRITIEGQQ-----NDAPVLGIIGQLGGVGARPEMIGLVSDADGAIAALASALKLAQMKQKGENLAGTVF 113 Pseudothermoto...
jgi:Elen_3066 121 VSTHVCPHAPTFPHEPVAFMGSPVATADVNREEVgGTQLDAVLVVDTTKGNRIMNKRGFMISPTVKQGCIMRVSEDLVSL 200 Eggerthella le...
Q0K4Y5         93 VTTHLSTNVSMQPHDPVPFMGMPVSSDTMNDYQV-LPEMDAILSIDASKGNSIIKHRGFAISPTAMQGYILRVAPDLVAT 171 Cupriavidus ne...
WP_011811021  125 VTTHLSLDASITPREPVDFMGMPVSSALMNLHEV-DPAMDAILSFDTSRGNRIIKQRGYAISPTIKEGYILRVSNDLVSV 203 Verminephrobac...
Q0K9C4        115 IHTHICPHAATRPHHPVPMMKSPFAMRTMMSHEV-HPRMAAILSVDTTRGNRFVNRRGVALTPVAKEGWLLRLPERMLDL 193 Cupriavidus ne...
WP_012186862  132 ITTNICPNAIVIPHEPAPLIRSPINLFEILRREV-KPEMDAILSVDATKANLVVKNLGFAITPTVKEGWILKVSPDLIKI 210 Caldivirga maq...
Q4J7P2        100 FVTNISLDAKLIPHRPFNFMVPLIGLDEALREEV-DREANLILSIDSTKGNRIAKYDDFAITHVIKDGYILKVKDELVDI 178 Sulfolobus aci...
WP_010923082  105 FVTNISLNAKLIPHQPFNFMVPLIGLDEALKEEV-DPKAGLILSIDSTKGNRLAKFDDFALTHVIKDGYILKLKDEVIDI 183 Saccharolobus ...
Q97ZB8        106 FVTNLSIKAKLIPHKPFDFMVPLVGLDEALKVEV-EPSASLVISIDSTKGNRIVKFDDFAITHVVKDGYILKLHDNVIDI 184 Saccharolobus ...
WP_014730786  114 VATHICPDAPTQRHEPVPFMGSPIGTRQALQAML-KRRLDAVISIDTTKGNRLINWKGIAITPTVKEGYILKVSDDLLDI 192 Mesotoga prima
WP_012002130  114 VATHICPHAPTIQHKPVPFMDSPVGVRQALKLMI-RRKLDAILSIDTTKGNRIAKKKGFAISPTVLKGYILKVSDNLLDI 192 Pseudothermoto...
jgi:Elen_3066 201 VEIATGRRARTYPLSMADITPYGNGLYHLNSILQPCT-ATDAPVVGVAITTETAVPGCATGATHLTDLDEAGSFMIEAAK 279 Eggerthella le...
Q0K4Y5        172 MESTTGCPAVTFPISQQDITPYHNGLYHFNSIMQPHV-ATRAPVVGVAVTARSVVSGSATSANHEIDIAEAVRFCVEVSK 250 Cupriavidus ne...
WP_011811021  204 METVSGRPAVTFPITMQDITPYDNGLYHFNSIMQPCV-ATSAPVVGVALIAQAIVAGSDSGASQEIDIAAAARFGVEVAK 282 Verminephrobac...
Q0K9C4        194 MGWVSGELPMVLPLTTQDITPYENGLWHVNSIMQPAI-VTPAPVVGVALTAQTTVPGCATGVTNAFDIDVATRFCIEVAK 272 Cupriavidus ne...
WP_012186862  211 YMNVTGRTPIIVPLTMQDIIPFTVPVYHINSIVQPWL-FTKSPVVGVAITTETVIPGSATNVTNLISLDQASRFILEVAY 289 Caldivirga maq...
Q4J7P2        179 YNRVTGHEVYFVPLTTGDLTPMEYNVYHISTLVSPWL-YSNSPLIGIATVSKQVVPGYVTGVQDVEMLEHASRFCLEVLK 257 Sulfolobus aci...
WP_010923082  184 YNRVTGHEVYLVSLTTGDLTPLDFNVYHISTLISPWL-YTDSPIIGIATVSKQMIPGYVTGVQDIEMLEHASRFCLEMLK 262 Saccharolobus ...
Q97ZB8        185 YNKITGHEIYMVPLTTGDLTPLDYNVSHISTLISPWL-YTDSPVIGIATVSKQVIPGYETGVLNIEMLEHASRFCIELLK 263 Saccharolobus ...
WP_014730786  193 CESVTGQPARVLPITMQDITPYGNRVHHINSIMQPCT-LLSVPVVGLAITTELAVPGCATGSSHELDIELAARFSLEVAK 271 Mesotoga prima
WP_012002130  193 YERVTGKEPFVLPITFQDITPYGNGVYHINSIMQPCTvAIDVPVVGVAITTQVPVAGCATGASSEVDIEQAARFCVEVAK 272 Pseudothermoto...
jgi:Elen_3066 280 AFGEGKCAFYDEDEYARFVERYGSMTHLQGMG 311 Eggerthella lenta DSM 2243
Q0K4Y5        251 RFGAGKCQFFNAAEWEKIRAVYPDLSVFQTAG 282 Cupriavidus necator H16
WP_011811021  283 QFTWGRCAFHSATEFAQMRKMYGPMTILQTMG 314 Verminephrobacter eiseniae
Q0K9C4        273 QFGQGQCDFYDAVEWAELQRRYGSLAHLQTVG 304 Cupriavidus necator H16
WP_012186862  290 EFTTGKMKFYDENEWNILKNTYGELSEIMRRG 321 Caldivirga maquilingensis
Q4J7P2        258 YVEKGG-TVYEESELKELKEKLGESSLMRLKR 288 Sulfolobus acidocaldarius
WP_010923082  263 YVEGGG-KVYDENELKELKEKLGESNLQRVKK 293 Saccharolobus solfataricus
Q97ZB8        264 YIENGG-KVYEEKELEELENRLGKSSLLKAKR 294 Saccharolobus solfataricus
WP_014730786  272 RFGQNKCKLFDHTEFERISGLYGDMSRLVfst 303 Mesotoga prima
WP_012002130  273 YFGRGEVRFYDKDEFKKIESLYGNLTFLVYAG 304 Pseudothermotoga lettingae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap