Conserved Protein Domain Family
L_lactis_ph-MCP

?
pfam06673: L_lactis_ph-MCP 
Lactococcus lactis bacteriophage major capsid protein
This family consists of several Lactococcus lactis bacteriophage major capsid proteins.
Statistics
?
PSSM-Id: 115336
View PSSM: pfam06673
Aligned: 2 rows
Threshold Bit Score: 639.126
Threshold Setting Gi: 75089519
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9MCB6   1 MGVNETQEMMKQAIEAGVKVRELETKVEELNKEREELKKEREANIPSEKPQDVERKFMRELGDKMTEMPEQGFLREFANA 80  Lactococcus phage Q44
Q9MCB8   1 MGANETQEIMKQAIEAGVKVRELEAKVEELNKEREELKKEREASIPSEKPEDAERKFMRELGSKMAEMPEQGFLREFANG 80  Lactococcus phage eb1
Q9MCB6  81 SALNVVNSLGSITSKYARKSGIYDGAMKARFQGLTLAEDGVDDTFIEGTFKAGTDKNKAQTASKRSLRPQMAEAYLQMDK 160 Lactococcus phage Q44
Q9MCB8  81 ADLNVVNSLGSITSKYARKSGIYDGAMKARFQGLTLAEDGVDDTFISGTFKAGTDKNKSQTATKRSLRPQMAEAYLQMDK 160 Lactococcus phage eb1
Q9MCB6 161 ATVRGVNDSGALSEYVMSEMVNRVIQKVEHNMILGSADGSNGFYGLKTATDGWTKQIEYTDLFDGITDAVAECSISDAIT 240 Lactococcus phage Q44
Q9MCB8 161 ATVRGVNDSGALSEYVMSEMVNRVIQKVEYNMILGSVDGSNGFYGLKTATDGWTKQIEYTDLFEGITDAVAECSISDAIT 240 Lactococcus phage eb1
Q9MCB6 241 IVMSPQTFAELRKAKGTDGHSRFNELATKEQIAQSFGAVNLETRVWMPKDEVAVYNHDEYVLIGDLNVENYNDFDLRYNV 320 Lactococcus phage Q44
Q9MCB8 241 IVMSPQTFAELRKAKGTDGHSRFNELATKEQIAQSFGAVNLETRVWMPKDEVAVYNHDEYVLIGDLNVENYNDFDLRYNV 320 Lactococcus phage eb1
Q9MCB6 321 EQWLSETLVGGSIRGKNRSAYLTKKAS 347 Lactococcus phage Q44
Q9MCB8 321 EQWLSETLVGGSIRGKNRSAYLKKKGS 347 Lactococcus phage eb1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap