Conserved Protein Domain Family
Etmic-2

?
pfam06670: Etmic-2 
Microneme protein Etmic-2
This family consists of several Microneme protein Etmic-2 sequences from Eimeria tenella. Etmic-2 is a 50 kDa acidic protein, which is found within the microneme organelles of Eimeria tenella sporozoites and merozoites.
Statistics
?
PSSM-Id: 115333
View PSSM: pfam06670
Aligned: 2 rows
Threshold Bit Score: 573.821
Threshold Setting Gi: 74834941
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9UAS0   1 MARALSLVALGLLFSLPPSSAVRTRVPGEDSFSPESGVLSGTDAPERRPnamrtcvttfcvraVVPGLVEGNCGRLTVRN 80  Eimeria tenella
Q24936   1 MARALSLVALGLLFSLPPSSAVRTRVPGEDSFSPESGVLSGTDAPERRP--------------IVPGLDEGNCGRLTVRN 66  Eimeria tenella
Q9UAS0  81 GLSVDETIKVTSAGWTKSERDFIVSLVADETRKVVQLRESEGASGASGPGPAPAEKPPSGQGSAEEAPKGEGGQEKPSVP 160 Eimeria tenella
Q24936  67 GLSVDETIKVTSAGWTKSERDFIVSLVADETRKVVQLRESEGASGASGPGPAPAEKPPSGQGSAEEAPKGEGGQEKPSVP 146 Eimeria tenella
Q9UAS0 161 LIAVRIHGSGGDKGESAPQSAVLLYGNDESEPTEVPLETAAGPTTPLMVLITQQNPKEVEVRVLAWISTeylcsrrgvsr 240 Eimeria tenella
Q24936 147 LIAVRIHGSGGDKGESAPQSAVLLYGNDESEPTEVPLETAAGPTTPLMVLITQQNPKEVEVRVLAWIST----------- 215 Eimeria tenella
Q9UAS0 241 ifkysdfcslcrDATTGKGSWKENSVVVGSSLSGRDLTVNLSDCGPSSLRVYGSASADLVTVKEGMCEADDPELIALTRP 320 Eimeria tenella
Q24936 216 ------------DATTGKGSWKENSVVVGSSLSGRDLTVNLSDCGPSSLRVYGSASADLVTVKEGMCEADDPELIALTRP 283 Eimeria tenella
Q9UAS0 321 HTSAASPLPAEEGDVAQDAQQSAGAQQEAEVQEVGEPQQEAAAAEQGSSAAESDTQQSS 379 Eimeria tenella
Q24936 284 HTSAASPLPAEEGDVAQDAQQSAGAQQEAEAQEVGEPQQEAAAAEQGSSAAESDTQQSS 342 Eimeria tenella
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap