Conserved Protein Domain Family
DUF1170

?
pfam06663: DUF1170 
Protein of unknown function (DUF1170)
This family represents a conserved region of unknown function within MAGUIN, a neuronal membrane-associated guanylate kinase-interacting protein. This region is situated between the pfam00595 and pfam00169 domains. All family members also contain an N-terminal pfam00536 domain.
Statistics
?
PSSM-Id: 399567
View PSSM: pfam06663
Aligned: 18 rows
Threshold Bit Score: 176.514
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_016080892  255 KKEKPAILDLYIPPPPDVPYSPRDEKGSFVCGGFPKYKHPLPGSKGSESPNSFLDQESRRRrFTIADSDQLPG-YSTQ-A 332  platypus
XP_018885322  335 KKEKSAILDLYIPPPPAVPYSPRDENGSFVYGGSSKCKQPLPGPKGSESPNSFLDQESRRRrFTIADSDQLPG-YSVE-T 412  western lowla...
Q8BMA3        335 KKEKPAILDLYIPPPPAVPYSPRDENVSFGYRGHSKSKQPLPVRKGSESPNSFLDQESQRRrFTIADSDQLPG-YSVE-T 412  house mouse
3_pfamImport    4 KKEKPAILDLYIPPPPAIPYAPRDEKGSFLYGGGNKPKQPLPGSKGAESPNSFLDQEFRRR-SNIES-EAVCHcLPLRrT 81  
XP_006000369  337 RKEKPAILDLYIPPPPAVPYTPRDDKGGIHRLGLQRPVL-----RGSESPNSFLDLEYGRRrFTIADSDQLAV-YSVE-A 409  coelacanth
XP_012947481  343 KMENSALQDVYILSPMSGLYGPRDEIGIMSCDDISKF--GKSGMKGSESPSYFLEHESGKY-YTLIEGEGHALgSEYErS 419  mallard
XP_022537553  293 KRDSSALQDLYIPPPPAEPYTPRDEQGNLPCDERGQG--GIPAAKGSESPNSFLDQEYRRR-YPLMEEEAVLYcYEYDpS 369  Mexican tetra
XP_015196988  342 KRDSSALQDLFIPPPPSEPYTPRDDKGNLPSDDITRHHAGIPVAKGSESPNSFLDQEYRKR-FTVLEEDAVLYcYEYDkG 420  spotted gar
Q8WXI2        342 KRDSSALQDLYIPPPPAEPYIPRDEKGNLPCEDLRGHMVGKPVHKGSESPNSFLDQEYRKR-FNIVEEDTVLYcYEYEkG 420  human
NP_001135662  335 KKEKPAILDLYIPPPPSVPYFPR---TEVGSSGSNRCVYPIPGSEGSESPNSFLDHESRRRwFTIANSDQLFS-SPLE-V 409  tropical claw...
XP_016080892  333 NILPTKMREK-TQFSGKPRPLSMPADGSWMGIVDPFAKPRGQGRRGDDVLCRYFSNERIPPIIEESFSSQHRFSRPMAER 411  platypus
XP_018885322  413 NILPTKMREK-TPSYGKPRPLSMPADGNWMGIVDPFARPRGHGRKGEDVLCRYFSNERIPPIIEESSSPPYRFSRPTTER 491  western lowla...
Q8BMA3        413 NVLPTKMRGK-TPSYGKPRPLSMPADGNWMGIVDPFAKPRGNGRKGEDALCRYFSNERITPITEESASPMYRFSRPLTER 491  house mouse
3_pfamImport   82 GVTSPKSPNGfSWSLGKPRPLSMPADGNWVGAAESFSKPRGMGRKGENVLCRYFSNERIPPIIEKF------------KR 149 
XP_006000369  410 NAQPAKMREK-KQSYGKPRPLSMPVDNSWVGAVEASSRLRFPGRKGDDALCRYFSNERIPPIIEESALTQHPS-KPMTDR 487  coelacanth
XP_012947481  420 RATGVRRREK-TPTHGDLRPVSMPTDYSWIGESKEQNMYKRGSRDSENSLLRYLSDDKILVIQEEP-LTQKDSKRDTGHR 497  mallard
XP_022537553  370 RGAPPSRRES-TPTYGRLRPISMPVEYNWVPDYEDPARPKREGRR-ENSMLRYVSEDKVP----EEYLTGRSAKRDTGKR 443  Mexican tetra
XP_015196988  421 R--GPSRRDA-TPTYGRLRPISMPVEYNWVGDYEDPSKMKREGRR-ENSLLRYVSEDKAP---PEEYMTQRSSKRDTGRR 493  spotted gar
Q8WXI2        421 RSSSQGRRES-TPTYGKLRPISMPVEYNWVGDYEDPNKMKRDSRR-ENSLLRYMSNEKIA---QEEYMFQRNSKKDTGKK 495  human
NP_001135662  410 KVQPAKLRDK-TPSYGKPRPLSMPAEPSWMVPPETYSRHRLAGKKGEGVLSRYFSNEQITPITEENIYSCSNLTKPASRR 488  tropical claw...
XP_016080892  412 QLVRGTDYIRGSRCYINSDLHSSATIPFQEEGTKKNSVRSSPKSSSAEPSLFVS 465  platypus
XP_018885322  492 HLVRGADYIRGSRCYINSDLHSSATIPFQEEGTKKKSGSSATKSSSTEPSLLVS 545  western lowland gorilla
Q8BMA3        492 HLVRGADYIRGSRCYINSDLHSSATIPFQEEGSKKKSASSSAKASSGEPSLLVS 545  house mouse
3_pfamImport  150 QL--------------------------KQDRGRKKK-----RKGSSSHSPINY 172 
XP_006000369  488 PLGRAADYIRGSRYFSNADLHSSATIPFQEDGAKKNSLTSRAKTTSTEPSLLVS 541  coelacanth
XP_012947481  498 -------------------------------SRKKG-KNASSPNYPISSSMLTS 519  mallard
XP_022537553  444 -------------------------------TKKKSEKSGSPAHYSLLPAlqme 466  Mexican tetra
XP_015196988  494 -------------------------------SKKKGDKGGSPSHYALLPAlqme 516  spotted gar
Q8WXI2        496 -------------------------------SKKKGDKSNSPTHYSLLPSlqmd 518  human
NP_001135662  489 -LVRGADYVRASPSLLNMDLHNSSTMPYQEDVEKKHNASSSSKNSSTEPSFLVS 541  tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap