Conserved Protein Domain Family
Strabismus

?
pfam06638: Strabismus 
Strabismus protein
This family consists of several strabismus (STB) or Van Gogh-like (VANGL) proteins 1 and 2. The exact function of this family is unknown. It is thought, however that STB1 gene and STB2 may be potent tumor suppressor gene candidates.
Statistics
?
PSSM-Id: 399556
View PSSM: pfam06638
Aligned: 17 rows
Threshold Bit Score: 750.341
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7Q072        40 HRTRHSH-------------------------------------RSsSNNHSRsGSNNKrpdm-------apfQTSVNL- 74  Anopheles gambi...
XP_005476776  24 RDRRDRH-------------------------------------RS-KSRDSS-SRGDK--------------SVTIQTp 50  Nile tilapia
XP_002613474  26 RDRKRRS-------------------------------------RGdHNHSSSlLKADR--------------SVTIQTp 54  Florida lancelet
EEC08043      20 snSRHHHqgnnihhqshqqhqqqnhtpnqhqhqnhdgqqsyrasRRhSHRSTRsc----------------ptQVKV--- 80  black-legged tick
NP_477177     45 ERDRSRH----------------------------------------SHRSTHsSKSAKgfqrg----dmapyQTSVNMt 80  fruit fly
OWR51627      14 SRRSSRH-------------------------------------RQhTHRSTRsSKSQRkesdn----mmapfQTSVNIn 52  Danaus plexippu...
XP_011269502  29 hsskqhH-------------------------------------RQhSHRTPRsTRSQRkerqnldtnemapfQTTVNVr 71  Florida carpent...
EEZ99288      28 HRDRNNY-------------------------------------RQhSHRSTRsSKSRKndem-------apfQTAVTLt 63  red flour beetle
XP_009858318  28 KRHRSHE-------------------------------------RGsRRHR---NRGEK--------------TVTIRTp 53  vase tunicate
XP_029696607  24 RERRDRY-------------------------------------RQ-KSRDAS-IRGEK--------------PGSIRVp 50  torafugu
Q7Q072        75 GDDGRD-GQEIIEVSIl---PQDETWGDNTTAITGnTSEQS-ISMEDVSY-FQM-----ADDRGVGFACQRYLERGLAVM 143 Anopheles gambi...
XP_005476776  51 G-EPLL-DAESTRGDD-----RDDNWGETTTVVTG-TSEHS-ISNEDLTR-VTK-----DLEESTPLECKRFVGPALGGC 115 Nile tilapia
XP_002613474  55 PHSTTG-GGDGEDGEE------DDNWGDNTTAITG-TSEQT--SMEDISR-MAK-----DMEDSIGLGSIQHLGVVIATM 118 Florida lancelet
EEC08043      81 GGDRRD---EVIEVQIl---PQDDNWGDNTTAITGnTSERS-VSAEDVSR-LGRgpgdqDTPGGL-FRCHMWAGTVLTGV 151 black-legged tick
NP_477177     81 GDGSHD-GQEVIEVQIl---PQDENWGENTTAVTGnTSEQS-ISMEDINNmWHR-----ESDKGFSFACRRYVESSFYFL 150 fruit fly
OWR51627      53 PETGRD-GQEVIEVQIl---PQDENWGENTTAVTGnTSEGS-QSMEDVSN-WPI-----EADSGLGFVCSRYFSTTIALG 121 Danaus plexippu...
XP_011269502  72 GDSVDNmGQEVIEVQIl---PQDENWGENTTAVTGnTSDRS-ESTEDVSH-WPN-----ETDGSFGSSCSRYVGPVVAMI 141 Florida carpent...
EEZ99288      64 PDN-RD-GQEVIEVQIl---PQDDNWGENTTAITGnTSEQS-QSTEDVSN-WPG-----EPDTGLSFVCQRYMGTVLTYI 131 red flour beetle
XP_009858318  54 PMDGRH-DSRATEGTIsvniPEDDNWGETNTFISG-TTDVTqLSHESLAK-LTK-----DIEASIGFRDCGYVGTII--- 122 vase tunicate
XP_029696607  51 P-ESLL-DEESTRGDD-----RDDNWGETTTVVTG-TSVDS-VSNEDLTK-IRK-----DLDDSLQPECRRYLSPALGAS 115 torafugu
Q7Q072       144 LCAVAFVSPLAMVVLPRVgffpaafesldlsqNERLRLL-A-CNAECKGMLVSLAARLLLLAIGLWALFLRQPAAIMPRI 221 Anopheles gambi...
XP_005476776 116 LSFFALVTPLAFLILPQV--------------LWRDALE-P-CGTPCEGLYVSLAFKLLVLLISSWALFLRPPRATLPRF 179 Nile tilapia
XP_002613474 119 LSFFAFLTPIAFVVLPLV--------------LWKETLD-P-CNTVCHGLFISFAFKLLILLIGAWALFFRRPRVVMPRV 182 Florida lancelet
EEC08043     152 LSLTAFLSPVVMVALPRVem-----------fEWKVQ---K-CGPECDGLLISFAFKLLILAVASWALFLRKPRATMPRI 216 black-legged tick
NP_477177    151 LGCGAFFSPVAMVVMPYVgffpsafdhpeitqTVRTQLL-A-CSEQCKGQLVSLAARLLLLAIGLWAVFMRRTSATMPRI 228 fruit fly
OWR51627     122 LSLVSFVSPLAMVVLPKLgffpgltdnlalqpSQRIQLL-S-CTAECKGILLSLAFKLVLLAIGVWAVFLRPRNAVLPRI 199 Danaus plexippu...
XP_011269502 142 LGISAFLSPIAMVILPKLgffpds--ttvltmQQKLQLL-S-CNAECKGQLLGLAFKLVLLGIGSWAVFLRPRIATMPRI 217 Florida carpent...
EEZ99288     132 LSIVAFLSPLAMVVLPKLgffpalssrlgladSAK--LL-A-CGAECKGQLVSLAFKMAILAVGAWAVFLRKPNATLPRF 207 red flour beetle
XP_009858318 123 FALISYLSPIAFVVMPKF--------------LWDNSSPlSaCGTSCKGTLISMSFKLLILLVASWAIFFRRQRTSMPKV 188 vase tunicate
XP_029696607 116 LGLLALITPLAFLLLPQL--------------LWRDALE-P-CGTPCEGLYISLAFKLLILLISTWALFLRPARAGLPRF 179 torafugu
Q7Q072       222 FLFRSCALLL-VLISSFAYWLFYIVQVTEGAraiv-sgssVVDYRTLVAYATSFCDTLLFVHYVAVVLLEIRHLQPLYHV 299 Anopheles gambi...
XP_005476776 180 FVFRCLLMVL-VFLFVASYWLFYGVRVLEPR---------ERDYRGIVEYAASLVDALLFIQYLALVLLEVRHLQPAFCL 249 Nile tilapia
XP_002613474 183 FVFRSMIMAL-VFVYTLSYWLFYGVRVLDER---------PSNYQDIVQYAVSLVDALLFIHYLAVILIELRHLRPQFIV 252 Florida lancelet
EEC08043     217 FILRAVVLAM-VFVFTFSYWLFFSVRVFEKRhq-----dyELTYLSIVQFALSLVDALLFIHYLAVILVEVRQLQPQFYV 290 black-legged tick
NP_477177    229 FLYRALVLLL-VTICTFAYWLFYIVQVTNGAkivvetggdAVDYKSLVGYATNFVDTLLFIHYVAVVLLELRHQQPCYYI 307 fruit fly
OWR51627     200 FVFRAMMLVI-LAVCAFSYWLFYFVQITEASkala-vgeeAMDYTSLVSYSSSFSDTLLFIHYAAVVLMEIRHLEPVYYV 277 Danaus plexippu...
XP_011269502 218 FLFRAGVLLL-TMLCICTYWLFYVVQITESAktaa--ngeISEYKSLVNYAGTLADTLLFIHYVAVLLIEVRHLQPTFYL 294 Florida carpent...
EEZ99288     208 FLFRAAVLAF-VLVCIFAYWLFYIVQVTETAraat-tpeeTVDYEALVAYALSLTDTLLFIHYLAVVLMEIRHQQPMYYI 285 red flour beetle
XP_009858318 189 FMFRSLIMVFvLLI-TLTYWLFYGIWILEQK---------EKDFQSIIEFSDSMTNCLLFVHYLSLVLLELRHLQTTFVL 258 vase tunicate
XP_029696607 180 FLFRCLLLAL-VFLFVASYWLFYGVRVLEPK---------ETDYRGIVGYAVSLVDALLFIQYLALVLLEVRHLRPAFSL 249 torafugu
Q7Q072       300 KVIRSPDGESHSYSIGQLSIQRAAVWVLQRYYTEFSIYNPYLERLPv--SKAQ--RKAAAvsSFKYYDV---DGATPAQ- 371 Anopheles gambi...
XP_005476776 250 KVVRSTDGASKFYNVGHLSIQRAAVWVLDRYYSDFPVYNPALLNLP---KSIL--SKKMT--GFKVYSLd--ENTTNN-- 318 Nile tilapia
XP_002613474 253 KVVRNTDGENRFYHVGQFSIQRAAVWLLEQYYRDFPPYNPALMHIP----TRA--PKQLT--GFKFYDV---DGNPGNA- 320 Florida lancelet
EEC08043     291 KIVRSPDGQSRSYAVGQLSIQRAAVWMLHKYYQDFPIYNPYLDTLPsrhRKQQqqLQQQS--AFKVYDV---DGGAMDEd 365 black-legged tick
NP_477177    308 KIIRSPDGVSRSYMLGQLSIQRAAVWVLQHYYVDFPIFNPYLERIPisvSKSQ--RNKISn-SFKYYEV---DGVSNSQ- 380 fruit fly
OWR51627     278 KVVRSPDGESRSYAIGQLSIQRAAVWVLQKYYTEFPIYNPYLEKIPi--SKSQ--RKGQG--SIKFYEV---DSNTNA-- 346 Danaus plexippu...
XP_011269502 295 KVVRSPDGESRSYAIGQLSIQRAAVWVLERYYTEFPIYNPYLERLPv--SKSG--RKQSS---FKFYEV---DGGVTGGm 364 Florida carpent...
EEZ99288     286 KVVRSPDGASRAYAIGQLSIQRAAVWVLEKYYTEFPIYNPYLERIPv--SKS---RKNSS--SFKFYEV---DGVNNSSl 355 red flour beetle
XP_009858318 259 EVIRTTDGERRFYNIGDLSIQRCSVWVLEKYYCDFPVYNPALMRIP----SRSarMKHINn-TFKVYDV---DGKPGND- 329 vase tunicate
XP_029696607 250 KVVRSTDGASRFYNVGYLSIQRAAVWVLDQYYSDFPVYNPALLNLP---KSIL--SKKMS--AFKIYNLgeaENGTDN-- 320 torafugu
Q7Q072       372 ----QQSQSRAVLAAHARRRDSSHNERFYEEHEYERRVKKRRARLVTAAEEAFTHIKRMQQpsspQQQHdqqgdgsgaAP 447 Anopheles gambi...
XP_005476776 319 ----STGQSRAMIAAAARRRDNSHNEYYYEEAEMDRRIRKRKARLVVAVEEAFTHIKRLQE----EEAAss------pKH 384 Nile tilapia
XP_002613474 321 ----SASQTRAMIAAAGRRHESIHKERYYEEQEYERRVKKRRVRFVCATEEAFTHIKRLSE----E------------RG 380 Florida lancelet
EEC08043     366 gdipPRNQTTVLPA-----RRSGHNDRFYEEHEYERRVRKRKARLVSAAEDAFTHIKRMHD----ENGq--------gTR 428 black-legged tick
NP_477177    381 ----QQSQSRAVLAANARRRDSSHNERFYEEHEYERRVKKRRARLITAAEEAFTHIKRIHN----EPA------------ 440 fruit fly
OWR51627     347 ----PSGQTRSASGSVSGRRNS-HNERYYEEAERARRVRKRRARLHSAAEDAFAHVRRVRL----TAA------------ 405 Danaus plexippu...
XP_011269502 365 q-srGGSGDRAVLAAQARRRDSSHNERFYEEHDYERRVRKRRARLITAAEEAFAHIKRLHS----EVEs---------TP 430 Florida carpent...
EEZ99288     356 ----QQSQSRAMLAAHARRRDSSHNERFYEEHEYERRVKKRRARLITAAEEAFTHIKRLHN----DQV------------ 415 red flour beetle
XP_009858318 330 ----TQGQNRAILAAVARRRDAGHNERYYEEAEYERRVRKRRARLVAATEDAFTHIRKASE----HEINtk------gKS 395 vase tunicate
XP_029696607 321 ----TTGQSRTTLSAASRRRDNSHNEFYYEEAEMERRVRKRKARLVVAVEEAFTHIKRHHA----EEAAss------pKH 386 torafugu
Q7Q072       448 PAIPLDPQEAAQAIFPSMARALQKYLRVTRQQPRHTVESILKHLAHCLKHDMSPRAFLEPYLVEAPVLQNDKER-RTNHN 526 Anopheles gambi...
XP_005476776 385 PREVMDPREAAQAIFAPMARAMQKYLRTTRQQAFHSMESILTHLQFCITHNMTPKAFLERYLTAGPTMQYQQQN-GRGRQ 463 Nile tilapia
XP_002613474 381 PAVPMDPHEAAQAIFPAFARPMQKYLRVTKQQPYHTMDSILKHLAFCIVHDCTPKAFLERYLTPGPSIQNESEI-HKKQK 459 Florida lancelet
EEC08043     429 PAIPMDPTEAAQAIFPSMARALQKYLRITRQQPRHTMQGILDHLAECLHYDLSPRAFLEKYLVSAPVLQDDREV-RPVQT 507 black-legged tick
NP_477177    441 PALPLDPQEAASAVFPSMARALQKYLRVTRQQPRHTFESILKHLAHCLKHDLSPRAFLEPYLTESPVMQSEKER-RWVQS 519 fruit fly
OWR51627     406 GGGALGPREAAQAVFPSLARALQKYLRATRQQPRHSAESVLAHLARCLSQDASPRAFLEPFLVEGPVLSAEQES-RTLQR 484 Danaus plexippu...
XP_011269502 431 NSGPMDPMEAAQAVFPSMARALQKYLRITRQQPRHSVESILNRLARCLAQDAAPRAFLEPFFVTSPVLSNEKERqKRSHH 510 Florida carpent...
EEZ99288     416 PAIPMDPHEAAQAIFPSMARALQKYLRVTRQQPRHSVESILTHLANCLSNDLTPKAFLEQYLVSEPVLQNDKEV-KDVQT 494 red flour beetle
XP_009858318 396 SNSVMECDAASEAIFPALARSLQKYLRTTRQHQHYQVEDIHKHLAFCIKNEMTPKAFLQRYINPGSYLTYDPR--HDSSQ 473 vase tunicate
XP_029696607 387 PREAMDPREAAQAIFAPLARAMQKYLRATRQQSYHTMESIINHLQFCITHNMTPKAFLEHYLGPGPTIQYLEPS--RGRQ 464 torafugu
Q7Q072       527 WALICD-ELLSRPLSDGCTFQLIQNDVSLTVSIHRIPHFTVSEEVVDPKSNKFVLKLNSETSV 588 Anopheles gambiae str. PEST
XP_005476776 464 WTLVSE-EPVTSALRQGLVFSLRRLDFSLVVTVTPLPFLRLGEEFIDPKSHKFVMRLQSETSV 525 Nile tilapia
XP_002613474 460 WTLVSD-LPLHNSLEPGMSFALREQSFSLLVTVMRIPTIKLKEDYQDPKSNKFVLRLQSETSV 521 Florida lancelet
EEC08043     508 WALVCD-VLLSRPLKPGVSFLLRQGEISLLVSVHALPHFNVTEEIVDPKSNRFVLRLNSETSV 569 black-legged tick
NP_477177    520 WSLICD-EIVSRPIGNECTFQLIQNDVSLMVTVHKLPHFNLAEEVVDPKSNKFVLKLNSETSV 581 fruit fly
OWR51627     485 WALVSD-DLLARPLADGVEFQLRQGDVSLICTIKSLPRFSLSEEVVDPKSNRFVLRLNSETSV 546 Danaus plexippus plexippus
XP_011269502 511 WALVCEgELPSRPIANGCEFQLRQGEVALLCTAHRLPHFNLTEQLAHPKSNKFLLRLNSETSV 573 Florida carpenter ant
EEZ99288     495 WALICE-ELLTRPIGDNTSFQLRQNDVSLLCTIKKIPHFNITEEVVDPKSNKFVLRLNSETSV 556 red flour beetle
XP_009858318 474 WDLVSD-EPLVNMLKDGTVFRLNQPEYSLVVTVRKSPRIGLQEVFIDPDSYRYVMHMQSETSV 535 vase tunicate
XP_029696607 465 WTLVSE-EPVTAAIHQGQVFSLRRTDFSLIVTVTSLPFLHLAEEFVDPKSHKFVMKLQSETSV 526 torafugu
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap