Conserved Protein Domain Family
PV-1

?
pfam06637: PV-1 
PV-1 protein (PLVAP)
This family consists of several PV-1 (PLVAP) proteins which seem to be specific to mammals. PV-1 is a novel protein component of the endothelial fenestral and stomatal diaphragms. The function of this family is unknown.
Statistics
?
PSSM-Id: 399555
View PSSM: pfam06637
Aligned: 8 rows
Threshold Bit Score: 628.41
Threshold Setting Gi: 395513371
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9BX97         1 MGLAMEHGGSYARAG-----GSSRGCWYYLRYFFLFVSLIQFLIILGLVLFMVYGNVHVSTESNLQATERRAEGLYSQLL 75  human
Q3ZC85         1 MGLAMEHGSPYSRAG-----SSSRGCWYYLRYFFLFVSLIQFLIILGLVLFMVYGNVHVSTESNLQATERRADGLYGQVV 75  cattle
XP_005333070   1 MGLAMEHRGAYSRAG-----DSPRGCWYYLRYFFLFVSLIQFLIILGLVLFMVYGNVHLSTESNLQATERRAESLYSQVV 75  thirteen-lined ...
Q91VC4         1 MGLSMDR-SPYARTG-----DQQRGCWYYLRYFFLFVSLIQFLIILGLVLFMIYGNVHATTESSLRATEIRADSLYSQVV 74  house mouse
ELW67180       1 MGLPMEHGGAYARAG-----GSPRGCWYYLRYFFLFVSLIQFLIILGLVLFMVYGNVHVSTEDNLQATERRAEGLFSQVV 75  Chinese tree shrew
XP_012664866   1 ----MDRGGAYSRAG-----GSPRGCWYYLRYFFLFVSLIQFLIILGLVLFMVYGNVHVSTESNLQATERRAGDLYSQVL 71  small-eared galago
XP_003760899   1 ----MDRSSSYSRTGlhissSENRGCWYYLKYFFLFVSLIQFLIILGLVLFMVYGNAHAGTEAHLEVTEKRADTLSGRLL 76  Tasmanian devil
XP_025313760   1 MGLPVEHGGAYARAG-----GSPRGCWYYLRYFFLFVSLIQFLIILGLVLFMVYGNVHVSTESNLQATERRAEGLYSQVV 75  dingo
Q9BX97        76 GLTASQSNLTKELNFTTRAKDAIMQMWLNARRDLDRINASFRQCQGDRVIYTNNQRYMAAIILSEKQCRDQFKDMNKSCD 155 human
Q3ZC85        76 GLTASQANLTKELNLTARAKEAINQMMLSARRDLDRINASFRQCQADRVIYMNNQRYMAAIILSEKQCQEHLKEANKSCD 155 cattle
XP_005333070  76 GLSAAQVNLSKELNITARTKDNIMQMLLSARRELERINASFRQCQSERAVYISREKYIVAIILSEQECQEQLKQANKSCN 155 thirteen-lined ...
Q91VC4        75 GLSASQANLSKQLNISLLVKETVMQQLLTTRREMERINASFRQCQGDLITYINYNRFIAAIILSEKQCQEQLKEVNKTCE 154 house mouse
ELW67180      76 GLTASQTNLSKELNLTSRAKDAIMQMLLSARRDLDRINASFRQCQGDRIIHANNQRFMAAIILSEKQCQEQLRESNKTCD 155 Chinese tree shrew
XP_012664866  72 GLMASQTNLSKELNLTSRAKDSIMQMLLSARRDLDRINASFRQCQSERVIHTNNERYVAAIIVSEKLCQDQLKEMNKSCE 151 small-eared galago
XP_003760899  77 NLGALNTNLSKELNITTRSREAIMQLLVGSRRDLDRINASYRQCQVDVNQHENNMKFVVAIVKSEEACRQQLAEHLRNCT 156 Tasmanian devil
XP_025313760  76 GLTASQANLSKELNLTSRAKETIMQLLLNARRDLDRINASfRQCQADRVVYMNNQRYMVAIILSEKQCQEQLKETNKSCN 155 dingo
Q9BX97       156 ALLFMLNQKVKTLEVEIAKEKTICTKDKESVLLNKRVAEEQLVECVKTRELQHQERQLAKEQLQKVQALCLPLDKDKFEM 235 human
Q3ZC85       156 ALALTLTQKAKTLEVELAKEKLVCTKDKDGLTVGKRVAEEQLAECGKTRDQQQQERQLAEDRLRKVQAFCIPLDRNKFET 235 cattle
XP_005333070 156 ALLYVWDQKAKALEMELAKEKVVCAQDKEGLLASKRAAEQQLVACNQVREQQQQERQLAQDRLQKVQALCLPLDKDKFEM 235 thirteen-lined ...
Q91VC4       155 ALLFKLGEKVKTLEMEVAKEKAVCSKDKESLLAGKRQTEEQLEACGKARERQQQEQQVTEENLRKVQSLCIPLDQEKFQA 234 house mouse
ELW67180     156 ALLLMLGQKAKTLEVELAKEKAVCTKDKESSSLSKRVVEDQLAECGKAREQLRLERQLVEGRLQKVQSVCLPFDKEKFET 235 Chinese tree shrew
XP_012664866 152 ALHLRSGEMAKKLEVELVKEKVVCTKDKEGLLLSKNVMEEQLTQCSKAQEQHQQERQLAEDKLQKVQSLCFQLDKDKFEN 231 small-eared galago
XP_003760899 157 AQIQALEEKAKTAQAVQETLKMACNKDKESLMAAKGLVESQFKACSAEKMSNFGEYQLVVGELQRVRDMCAAVDKEKLVS 236 Tasmanian devil
XP_025313760 156 ALFLMLNQKAKTLEMEVAKEKQVCTKDKEALVLSKRVVEEQLAECGKAREQQRQERQLAEDRLQKVQTLCLPLDKDKFET 235 dingo
Q9BX97       236 DLRNLWRDSIIPRSLDNLGYNLYHPL--GSELASIRRACDHMPSLMSSKVEELARSLRADIERVARENSDLQRQKLEAQQ 313 human
Q3ZC85       236 DLRNLWRDSIIPRTLSTLSFNLYHPL--GSELPSIQRACDSLPSIMTSKVEELARSLRAGIDSVTLENEKLQRQKLEVEQ 313 cattle
XP_005333070 236 DLRNLWKDSIVSRSLETLGYNMGYPMisHSDVISIRRTCDQMPSIMSTKVEELARSLRAGIERVARENSDLQRQKLEAEQ 315 thirteen-lined ...
Q91VC4       235 DVLSAWRDSLIYRTLETLPY--HYQL--MPEYASLRRTCESLPGIMTTKIEELARGLRAGIERVTRENAELRRQKLELER 310 house mouse
ELW67180     236 DLQNLWRDSIIPRTLDTFGYGLYSHI--NPELNSIRRTCDHMPTLMASKVDELARSLRSGIERVARENSDLQRQKLEAEQ 313 Chinese tree shrew
XP_012664866 232 DLRNLWRDSIIPRTLDSLSYGVYHPL--GSDILSIQRMCNQLPSLMSTKVEELARSLRASIESVARENSDLQRQKLQAEQ 309 small-eared galago
XP_003760899 237 KMEQVWRESLLYKSLDSI-ALLYY----NPEVEKVVHRCRELPRVMLDKVESLARELKVGIEQVARENTELKRQKEAGEK 311 Tasmanian devil
XP_025313760 236 ELRNLWRDSIIPRTLDTMSYNLYHPL--GSEITSIRRSCDHMPTLMSTKVEELARSLRAGIERVARENADIQRQKLEVEQ 313 dingo
Q9BX97       314 GLRASQEAKQKVEKEAQAREAKLQAECSRQTQLALEEKAVLRKERDNLAKELEEKKREAEQLRMELAIRNSALDTCIKTK 393 human
Q3ZC85       314 SLRASQEAKEKVEKEAQAQAVKLQAECARQTQLALEEKVALQKERDRLVKELEEKKREAEHLKLQLAVSNSALDTCIKAK 393 cattle
XP_005333070 316 SLRASQEAKEQAEKEARAREAKIQAGCTQQVQLALEEKAVLRRERDNLAKELAEKKREVEQLKMQMDVRISALDTCLKAK 395 thirteen-lined ...
Q91VC4       311 AAQAAQEARARAGTEAQARETQLRAECARQTQLALEEKAALRAQRDNLERELEARKRELEQLRTEVDVRISALDTCVKAK 390 house mouse
ELW67180     314 NLQASQAAKEKVEKEAQGREAKLHAECARQTQLALEEKAVLRKERDNLAKELEEKKKEVEHLKMQLAVANSALDTCIKAK 393 Chinese tree shrew
XP_012664866 310 SLRASQEAKEKVEKEAQAREAKLQAECSRQTQLALEEKATLRKERDNMAKELEEKKREVEQLKMQLAVSNTALDTCIRAK 389 small-eared galago
XP_003760899 312 SLAACKEEKDKVLKETQERLQKVHEDCVKQARLALEEKVALQKEKDALKKELEEKKKELALTKGQLDINTATLETCIRTK 391 Tasmanian devil
XP_025313760 314 ALKASQEAKEKLEKEAQAREAKLQAECARQTQLALEEKATLRKERDTLAKELEEKKRDAEQLRMQLAVSNSALDTCIKAK 393 dingo
Q9BX97       394 SQPMMPVSRPMGPV--PNPQPIDPASLEEFKRKILESQR---PPAGIPVAPS 440 human
Q3ZC85       394 SQLTIPGPRPAVPV--PNPPPIDPASLEEFKRRILDSQR---APASNVLVSA 440 cattle
XP_005333070 396 SQS-IPLPRPVGPVpqPQPQPIDPASLEEFKKRILESQR---SPAGNPAVLS 443 thirteen-lined ground squirrel
Q91VC4       391 SLPAVP-PRVSGPP--PNPPPIDPASLEEFKKRILESQR---LPVVNPAAQP 436 house mouse
ELW67180     394 G------------A--GSRCPVDPASLEEFKKRILESQR---PPAGNLPAsp 428 Chinese tree shrew
XP_012664866 390 SQP-IPLPRPVGPA--PNPPPIDPVSLEEFKKRILESQR---TSIGNPAAPS 435 small-eared galago
XP_003760899 392 AQGSTLLPRPPVPA---KPAPLDLEALEEFKRRLMNTYQkasQPSGNPASg- 439 Tasmanian devil
XP_025313760 394 SQP-IPIPRPAGPA--PNPQPIDPAGLEEFKRRILESQR---PPAANAVAPS 439 dingo
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap