Conserved Protein Domain Family
NolV

?
pfam06635: NolV 
Nodulation protein NolV
This family consists of several nodulation protein NolV sequences from different Rhizobium species. The function of this family is unclear.
Statistics
?
PSSM-Id: 399554
View PSSM: pfam06635
Aligned: 2 rows
Threshold Bit Score: 361.34
Threshold Setting Gi: 499397156
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_028181536   1 MTADALAPPAAPKIRALGPLIPAAQLEIWHDAIQALAAAERHLQRVRGWARLAYERERAQGRAEGAKAGAEEMARLIAQA 80  Bradyrhizobium
WP_011084623   1 MTADALAPPAAPKIRALGPLIPAAQLEIWHDAIQALAAAERHLQRVRGWARLAYERERAQGRAEGAKAGAEEMARLIAQA 80  Bradyrhizobium
WP_028181536  81 TCELAQRKAVLERELPQLVFEIVRDLLGAFDSGKMLVQCVRHAIEQRYKNTEVCLHVSPLKADLLASEFKDYDGLEGRPK 160 Bradyrhizobium
WP_011084623  81 TCELAQRKAVLERELPQLVFEIVRDLLGAFDSGKMLVQCVRHAIEQRYKNTEVCLHVSPLKADLLASEFKDYDGLEGRPK 160 Bradyrhizobium
WP_028181536 161 VRIEADPALSADQCVLWSEFGNVDLGLAAQLRALRLGFGLTEEAES 206 Bradyrhizobium
WP_011084623 161 LRIEADPALSADQCVLWSEFGNVDLGLAAQLRALRLGFGLTEEAES 206 Bradyrhizobium
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap